|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric/Biological Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 4B9C) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 4B9C) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 4B9C) |
PROSITE Motifs (1, 1)
Asymmetric/Biological Unit (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 4B9C) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:150 aligned with RSGI1_CLOTH | A3DBH1 from UniProtKB/Swiss-Prot Length:486 Alignment length:150 345 355 365 375 385 395 405 415 425 435 445 455 465 475 485 RSGI1_CLOTH 336 DGTKGLKIQYYSRKPHDSAGIDFSFRMFNTGNEAIDLKDVKVRYYFKEDVSIDEMNWAVYFYSLGSEKDVQCRFYELPGKKEANKYLEITFKSGTLSPNDVMYITGEFYKNDWTKFEQRDDYSYNPADSYSDWKRMTAYISNKLVWGIEP 485 SCOP domains d4b9ca_ A: automated matches SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE CBM3 PDB: A:5-150 UniProt: 336-486 PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 4b9c A 1 GSHMGLKIQYYSRKPHDSAGIDFSFRMFNTGNEAIDLKDVKVRYYFKEDVSIDEMNWAVYFYSLGSEKDVQCRFYELPGKKEANKYLEITFKSGTLSPNDVMYITGEFYKNDWTKFEQRDDYSYNPADSYSDWKRMTAYISNKLVWGIEP 150 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 4B9C) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 4B9C) |
Gene Ontology (6, 6)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (RSGI1_CLOTH | A3DBH1)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|