|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 2) Biological Unit 1 (2, 4) Biological Unit 2 (0, 0) |
Asymmetric Unit (2, 2)
|
Asymmetric Unit
|
(no "Cis Peptide Bond" information available for 4AEA) |
(no "SAP(SNP)/Variant" information available for 4AEA) |
Asymmetric Unit (1, 2)
|
(no "Exon" information available for 4AEA) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:68 aligned with 3L21_NAJKA | P01391 from UniProtKB/Swiss-Prot Length:71 Alignment length:69 10 20 30 40 50 60 3L21_NAJKA 1 IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTDNCNPFPTRK 69 SCOP domains d4aeaa_ A: alpha-Cobratoxin SCOP domains CATH domains --------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------SNAKE_TOXIN --------- PROSITE Transcript --------------------------------------------------------------------- Transcript 4aea A 1 IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTDNCNPFPT-G 1068 10 20 30 40 50 60 | | 67 | 1068 Chain B from PDB Type:PROTEIN Length:67 aligned with 3L21_NAJKA | P01391 from UniProtKB/Swiss-Prot Length:71 Alignment length:67 10 20 30 40 50 60 3L21_NAJKA 1 IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTDNCNPFPT 67 SCOP domains d4aeab_ B: alpha-Cobratoxin SCOP domains CATH domains ------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------SNAKE_TOXIN ------- PROSITE Transcript ------------------------------------------------------------------- Transcript 4aea B 1 IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTDNCNPFPT 67 10 20 30 40 50 60
|
Asymmetric Unit
|
(no "CATH Domain" information available for 4AEA) |
(no "Pfam Domain" information available for 4AEA) |
Asymmetric Unit(hide GO term definitions) Chain A,B (3L21_NAJKA | P01391)
|
|
|
|
|
|
|