3ZGC - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF THE KEAP1-NEH2 COMPLEX

Authors :   S. Hoerer, D. Reinert, K. Ostmann, Y. Hoevels, H. Nar

Date :   17 Dec 12 (Deposition) - 12 Jun 13 (Release) - 12 Jun 13 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.20

Chains :   Asym. Unit : A,B,C
Biol. Unit 1: A,C  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Transcription, Protein-Peptide Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. Horer, D. Reinert, K. Ostmann, Y. Hoevels, H. Nar
Crystal-Contact Engineering To Obtain A Crystal Form Of The Kelch Domain Of Human Keap1 Suitable For Ligand-Soaking Experiments.
Acta Crystallogr. , Sect. F V. 69 592 2013
PubMed-ID: 23722832 | Reference-DOI: 10.1107/S174430911301124X

Molecule 1 - KELCH-LIKE ECH-ASSOCIATED PROTEIN 1
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Variant	:	PLYSS
	Expression System Vector	:	PET15B
	Expression System Vector Type	:	PLASMID
	Fragment	:	KELCH DOMAIN OF HUMAN KEAP1, RESIDUES 321-609
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	CYTOSOLIC INHIBITOR OF NRF2, INRF2, KELCH-LIKE PROTEIN 19

Molecule 2 - NUCLEAR FACTOR ERYTHROID 2-RELATED FACTOR 2
	Chains	:	C
	Fragment	:	RESIDUES 76-82
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	NF-E2-RELATED FACTOR 2, NFE2-RELATED FACTOR 2, HEBP1, NUCLEAR FACTOR, ERYTHROID DERIVED 2, LIKE 2, NEH2-DERIVED PEPTIDE
	Synthetic	:	YES

		1	2	3
Asymmetric Unit	:	A	B	C
Biological Unit 1 (1x)	:	A		C
Biological Unit 2 (1x)	:		B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 10)

No.	Name	Count	Type	Full Name
1	ACT	10	Ligand/Ion	ACETATE ION

Biological Unit 1 (1, 4)

No.	Name	Count	Type	Full Name
1	ACT	4	Ligand/Ion	ACETATE ION

Biological Unit 2 (1, 6)

No.	Name	Count	Type	Full Name
1	ACT	6	Ligand/Ion	ACETATE ION

Asymmetric Unit (10, 10)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	TYR B:491 , PRO B:492 , GLU B:493 , ARG B:494 , HOH B:2157	BINDING SITE FOR RESIDUE ACT B1610
02	AC2	SOFTWARE	TYR A:491 , PRO A:492 , GLU A:493 , ARG A:494 , HOH A:2170	BINDING SITE FOR RESIDUE ACT A1610
03	AC3	SOFTWARE	ASP A:385 , GLY A:386 , HOH A:2064 , PHE B:478 , ARG B:483 , SER B:508	BINDING SITE FOR RESIDUE ACT B1611
04	AC4	SOFTWARE	MET A:399 , TYR A:473 , TYR A:491 , TYR A:537 , HOH A:2235	BINDING SITE FOR RESIDUE ACT A1611
05	AC5	SOFTWARE	MET B:399 , TYR B:473 , TYR B:491 , TYR B:537	BINDING SITE FOR RESIDUE ACT B1612
06	AC6	SOFTWARE	VAL A:411 , HIS A:432 , ILE A:435 , HIS A:437 , HOH A:2113	BINDING SITE FOR RESIDUE ACT A1612
07	AC7	SOFTWARE	PRO A:384 , TYR B:334 , SER B:363 , ARG B:380 , ASN B:382 , ACT B:1615	BINDING SITE FOR RESIDUE ACT B1613
08	AC8	SOFTWARE	CYS A:434 , ILE A:435 , HIS A:436 , ARG A:459 , HOH A:2152	BINDING SITE FOR RESIDUE ACT A1613
09	AC9	SOFTWARE	VAL B:411 , HIS B:432 , HIS B:437	BINDING SITE FOR RESIDUE ACT B1614
10	BC1	SOFTWARE	PRO A:384 , ARG B:415 , ALA B:556 , SER B:602 , GLY B:603 , ACT B:1613 , HOH B:2035	BINDING SITE FOR RESIDUE ACT B1615

(no "SS Bond" information available for 3ZGC)

(no "Cis Peptide Bond" information available for 3ZGC)

Asymmetric Unit (6, 12)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_032105	G	333	C	KEAP1_HUMAN	Unclassified	---	A/B	G	333	C
2	UniProt	VAR_032106	D	349	N	KEAP1_HUMAN	Polymorphism	1048289	A/B	D	349	N
3	UniProt	VAR_032107	G	350	S	KEAP1_HUMAN	Polymorphism	777308626	A/B	G	350	S
4	UniProt	VAR_032108	G	364	C	KEAP1_HUMAN	Unclassified	---	A/B	G	364	C
5	UniProt	VAR_032109	G	430	C	KEAP1_HUMAN	Unclassified	---	A/B	G	430	C
6	UniProt	VAR_036085	A	522	V	KEAP1_HUMAN	Unclassified	---	A/B	A	522	V

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (6, 6)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_032105	G	333	C	KEAP1_HUMAN	Unclassified	---	A	G	333	C
2	UniProt	VAR_032106	D	349	N	KEAP1_HUMAN	Polymorphism	1048289	A	D	349	N
3	UniProt	VAR_032107	G	350	S	KEAP1_HUMAN	Polymorphism	777308626	A	G	350	S
4	UniProt	VAR_032108	G	364	C	KEAP1_HUMAN	Unclassified	---	A	G	364	C
5	UniProt	VAR_032109	G	430	C	KEAP1_HUMAN	Unclassified	---	A	G	430	C
6	UniProt	VAR_036085	A	522	V	KEAP1_HUMAN	Unclassified	---	A	A	522	V

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (6, 6)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_032105	G	333	C	KEAP1_HUMAN	Unclassified	---	B	G	333	C
2	UniProt	VAR_032106	D	349	N	KEAP1_HUMAN	Polymorphism	1048289	B	D	349	N
3	UniProt	VAR_032107	G	350	S	KEAP1_HUMAN	Polymorphism	777308626	B	G	350	S
4	UniProt	VAR_032108	G	364	C	KEAP1_HUMAN	Unclassified	---	B	G	364	C
5	UniProt	VAR_032109	G	430	C	KEAP1_HUMAN	Unclassified	---	B	G	430	C
6	UniProt	VAR_036085	A	522	V	KEAP1_HUMAN	Unclassified	---	B	A	522	V

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 3ZGC)

Asymmetric Unit (5, 9)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.2	ENST00000393623	2	ENSE00001516066	chr19:10613481-10613373	109	KEAP1_HUMAN	-	0	0	-	-
1.3	ENST00000393623	3	ENSE00001217274	chr19:10610756-10610071	686	KEAP1_HUMAN	1-213	213	0	-	-
1.4	ENST00000393623	4	ENSE00001217262	chr19:10602938-10602253	686	KEAP1_HUMAN	214-442	229	2	A:325-442 B:325-442	118 118
1.5	ENST00000393623	5	ENSE00000679299	chr19:10600529-10600324	206	KEAP1_HUMAN	442-511	70	2	A:442-511 B:442-511	70 70
1.6	ENST00000393623	6	ENSE00000679301	chr19:10600044-10599868	177	KEAP1_HUMAN	511-570	60	2	A:511-570 B:511-570	60 60
1.7	ENST00000393623	7	ENSE00001371225	chr19:10597494-10596796	699	KEAP1_HUMAN	570-624	55	2	A:570-609 B:570-609	40 40

2.5a	ENST00000397062	5a	ENSE00001782317	chr2:178129859-178129260	600	NF2L2_HUMAN	1-15	15	0	-	-
2.9c	ENST00000397062	9c	ENSE00001743774	chr2:178098999-178098733	267	NF2L2_HUMAN	16-104	89	1	C:76-82 (gaps)	52
2.10a	ENST00000397062	10a	ENSE00001650889	chr2:178098067-178097978	90	NF2L2_HUMAN	105-134	30	0	-	-
2.10c	ENST00000397062	10c	ENSE00001667839	chr2:178097311-178097120	192	NF2L2_HUMAN	135-198	64	0	-	-
2.11d	ENST00000397062	11d	ENSE00001920137	chr2:178096736-178095033	1704	NF2L2_HUMAN	199-605	407	0	-	-

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:285
 aligned with KEAP1_HUMAN | Q14145 from UniProtKB/Swiss-Prot  Length:624

    Alignment length:285
                                   334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514       524       534       544       554       564       574       584       594       604     
          KEAP1_HUMAN   325 GRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVT 609
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee..........eeeee....eeee...........eeeee..eeeee..eeee..eeee...eeeee....eeee...........eeeee..eeeee..ee..ee...eeeee....eeee...........eeeee..eeeeeeee....eeeeeeeee....eeee...........eeeee..eeeee...........eeeee....eeee...........eeeee..eeeee..........eeeeee....eeeeeee........eeeee Sec.struct. author
                 SAPs(SNPs) --------C---------------NS-------------C-----------------------------------------------------------------C-------------------------------------------------------------------------------------------V--------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.4  PDB: A:325-442 UniProt: 214-442 [INCOMPLETE]                                                                --------------------------------------------------------------------Exon 1.6  PDB: A:511-570 UniProt: 511-570                   --------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------------------------------------------------------Exon 1.5  PDB: A:442-511 UniProt: 442-511                             ----------------------------------------------------------Exon 1.7  PDB: A:570-609 [INCOMPLETE]    Transcript 1 (2)
                 3zgc A 325 GRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVATATWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVT 609
                                   334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514       524       534       544       554       564       574       584       594       604

Chain B from PDB  Type:PROTEIN  Length:285
 aligned with KEAP1_HUMAN | Q14145 from UniProtKB/Swiss-Prot  Length:624

    Alignment length:285
                                   334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514       524       534       544       554       564       574       584       594       604     
          KEAP1_HUMAN   325 GRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVT 609
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee..........eeeee....eeee...........eeeee..eeeee..eeee..eeee...eeeee....eeee...........eeeee..eeeee..ee..ee...eeeee....eeee...........eeeee..eeeeeeee....eeeeeeeee....eeee...........eeeee..eeeee...........eeeee....eeeee..........eeeee..eeeee..........eeeeee....eeeeeee........eeeee Sec.struct. author
                 SAPs(SNPs) --------C---------------NS-------------C-----------------------------------------------------------------C-------------------------------------------------------------------------------------------V--------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.4  PDB: B:325-442 UniProt: 214-442 [INCOMPLETE]                                                                --------------------------------------------------------------------Exon 1.6  PDB: B:511-570 UniProt: 511-570                   --------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------------------------------------------------------Exon 1.5  PDB: B:442-511 UniProt: 442-511                             ----------------------------------------------------------Exon 1.7  PDB: B:570-609 [INCOMPLETE]    Transcript 1 (2)
                 3zgc B 325 GRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVATATWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVT 609
                                   334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514       524       534       544       554       564       574       584       594       604

Chain C from PDB  Type:PROTEIN  Length:7
 aligned with NF2L2_HUMAN | Q16236 from UniProtKB/Swiss-Prot  Length:605

    Alignment length:52
                                    40        50        60        70        80  
          NF2L2_HUMAN    31 GVSREVFDFSQRRKEYELEKQKKLEKERQEQLQKEQEKAFFAQLQLDEETGE  82
               SCOP domains ---------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------- Pfam domains
         Sec.struct. author .---------------------------------------------...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------- PROSITE
               Transcript 2 Exon 2.9c  PDB: C:76-82 (gaps) UniProt: 16-104       Transcript 2
                 3zgc C  76 G---------------------------------------------DEETGE  82
                            |        -         -         -         -      | 80  
                           76                                            77

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 3ZGC)

(no "CATH Domain" information available for 3ZGC)

(no "Pfam Domain" information available for 3ZGC)

Asymmetric Unit(hide GO term definitions)

Chain A,B (KEAP1_HUMAN | Q14145)

molecular function
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0008134	transcription factor binding	Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
	GO:0004842	ubiquitin-protein transferase activity	Catalysis of the transfer of ubiquitin from one protein to another via the reaction X-Ub + Y --> Y-Ub + X, where both X-Ub and Y-Ub are covalent linkages.
biological process
	GO:0019694	alkanesulfonate metabolic process	The chemical reactions and pathways involving alkanesulfonates, the anion of alkanesulfonic acids, sulfonic acid derivatives containing an aliphatic hydrocarbon group.
	GO:0071353	cellular response to interleukin-4	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an interleukin-4 stimulus.
	GO:0071407	cellular response to organic cyclic compound	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic cyclic compound stimulus.
	GO:0042994	cytoplasmic sequestering of transcription factor	The selective interaction of a transcription factor with specific molecules in the cytoplasm, thereby inhibiting its translocation into the nucleus.
	GO:0009812	flavonoid metabolic process	The chemical reactions and pathways involving flavonoids, a group of water-soluble phenolic derivatives containing a flavan skeleton including flavones, flavonols and flavanoids, and anthocyanins.
	GO:0001701	in utero embryonic development	The process whose specific outcome is the progression of the embryo in the uterus over time, from formation of the zygote in the oviduct, to birth. An example of this process is found in Mus musculus.
	GO:0006108	malate metabolic process	The chemical reactions and pathways involving malate, the anion of hydroxybutanedioic acid, a chiral hydroxydicarboxylic acid. The (+) enantiomer is an important intermediate in metabolism as a component of both the TCA cycle and the glyoxylate cycle.
	GO:0010629	negative regulation of gene expression	Any process that decreases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
	GO:0043433	negative regulation of sequence-specific DNA binding transcription factor activity	Any process that stops, prevents, or reduces the frequency, rate or extent of the activity of a transcription factor, any factor involved in the initiation or regulation of transcription.
	GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	Any process that activates or increases the frequency, rate or extent of the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
	GO:0010499	proteasomal ubiquitin-independent protein catabolic process	The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome but do not involve ubiquitin.
	GO:0051259	protein oligomerization	The process of creating protein oligomers, compounds composed of a small number, usually between three and ten, of component monomers; protein oligomers may be composed of different or identical monomers. Oligomers may be formed by the polymerization of a number of monomers or the depolymerization of a large protein polymer.
	GO:0016567	protein ubiquitination	The process in which one or more ubiquitin groups are added to a protein.
	GO:0042787	protein ubiquitination involved in ubiquitin-dependent protein catabolic process	The process in which a ubiquitin group, or multiple groups, are covalently attached to the target protein, thereby initiating the degradation of that protein.
	GO:0045604	regulation of epidermal cell differentiation	Any process that modulates the frequency, rate or extent of epidermal cell differentiation.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0035902	response to immobilization stress	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of being rendered immobile.
	GO:0010038	response to metal ion	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a metal ion stimulus.
	GO:0097066	response to thyroid hormone	A change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a thyroid hormone stimulus.
	GO:0001887	selenium compound metabolic process	The chemical reactions and pathways involving compounds that contain selenium, such as selenocysteine.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0031463	Cul3-RING ubiquitin ligase complex	A ubiquitin ligase complex in which a cullin from the Cul3 subfamily and a RING domain protein form the catalytic core; substrate specificity is conferred by a BTB-domain-containing protein.
	GO:0005884	actin filament	A filamentous structure formed of a two-stranded helical polymer of the protein actin and associated proteins. Actin filaments are a major component of the contractile apparatus of skeletal muscle and the microfilaments of the cytoskeleton of eukaryotic cells. The filaments, comprising polymerized globular actin molecules, appear as flexible structures with a diameter of 5-9 nm. They are organized into a variety of linear bundles, two-dimensional networks, and three dimensional gels. In the cytoskeleton they are most highly concentrated in the cortex of the cell just beneath the plasma membrane.
	GO:0005913	cell-cell adherens junction	An adherens junction which connects a cell to another cell.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0005815	microtubule organizing center	An intracellular structure that can catalyze gamma-tubulin-dependent microtubule nucleation and that can anchor microtubules by interacting with their minus ends, plus ends or sides.
	GO:0030496	midbody	A thin cytoplasmic bridge formed between daughter cells at the end of cytokinesis. The midbody forms where the contractile ring constricts, and may persist for some time before finally breaking to complete cytokinesis.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain C (NF2L2_HUMAN | Q16236)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0001102	RNA polymerase II activating transcription factor binding	Interacting selectively and non-covalently with an RNA polymerase II transcription activating factor, a protein involved in positive regulation of transcription.
	GO:0000980	RNA polymerase II distal enhancer sequence-specific DNA binding	Interacting selectively and non-covalently with a RNA polymerase II (Pol II) distal enhancer. In mammalian cells, enhancers are distal sequences that increase the utilization of some promoters, and can function in either orientation and in any location (upstream or downstream) relative to the core promoter.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0019904	protein domain specific binding	Interacting selectively and non-covalently with a specific domain of a protein.
	GO:0043565	sequence-specific DNA binding	Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
	GO:0001221	transcription cofactor binding	Interacting selectively and non-covalently with a transcription cofactor, any protein involved in regulation of transcription via protein-protein interactions with transcription factors and other transcription regulatory proteins. Cofactors do not bind DNA directly, but rather mediate protein-protein interactions between regulatory transcription factors and the basal transcription machinery.
	GO:0003700	transcription factor activity, sequence-specific DNA binding	Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
	GO:0044212	transcription regulatory region DNA binding	Interacting selectively and non-covalently with a DNA region that regulates the transcription of a region of DNA, which may be a gene, cistron, or operon. Binding may occur as a sequence specific interaction or as an interaction observed only once a factor has been recruited to the DNA by other factors.
	GO:0000976	transcription regulatory region sequence-specific DNA binding	Interacting selectively and non-covalently with a specific sequence of DNA that is part of a regulatory region that controls transcription of that section of the DNA. The transcribed region might be described as a gene, cistron, or operon.
	GO:0001205	transcriptional activator activity, RNA polymerase II distal enhancer sequence-specific binding	Interacting selectively and non-covalently with a sequence of DNA that is in a distal enhancer region for RNA polymerase II (RNAP II) in order to activate or increase the frequency, rate or extent of transcription from the RNAP II promoter.
biological process
	GO:0036499	PERK-mediated unfolded protein response	A series of molecular signals mediated by the endoplasmic reticulum membrane stress sensor PERK (PKR-like ER kinase). Begins with activation of PERK in response to endoplasmic reticulum (ER) stress and ends with regulation of a downstream cellular process, e.g. transcription. The main substrate of PERK is the translation initiation factor eIF2alpha. Serine-phosphorylation of eIF2alpha by PERK inactivates eIF2alpha and inhibits general protein translation. In addition, eIF2alpha phosphorylation preferentially increases the translation of selective mRNAs such as ATF4 (activating transcription factor 4), which up regulates a subset of UPR genes required to restore folding capacity.
	GO:0045454	cell redox homeostasis	Any process that maintains the redox environment of a cell or compartment within a cell.
	GO:0035690	cellular response to drug	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
	GO:0071498	cellular response to fluid shear stress	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a fluid shear stress stimulus. Fluid shear stress is the force acting on an object in a system where the fluid is moving across a solid surface.
	GO:0042149	cellular response to glucose starvation	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of deprivation of glucose.
	GO:0070301	cellular response to hydrogen peroxide	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a hydrogen peroxide (H2O2) stimulus.
	GO:0071499	cellular response to laminar fluid shear stress	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a laminar fluid shear stress stimulus. Laminar fluid flow is the force acting on an object in a system where the fluid is moving across a solid surface in parallel layers.
	GO:0034599	cellular response to oxidative stress	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of oxidative stress, a state often resulting from exposure to high levels of reactive oxygen species, e.g. superoxide anions, hydrogen peroxide (H2O2), and hydroxyl radicals.
	GO:0071356	cellular response to tumor necrosis factor	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a tumor necrosis factor stimulus.
	GO:0030968	endoplasmic reticulum unfolded protein response	The series of molecular signals generated as a consequence of the presence of unfolded proteins in the endoplasmic reticulum (ER) or other ER-related stress; results in changes in the regulation of transcription and translation.
	GO:0006954	inflammatory response	The immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents. The process is characterized by local vasodilation, extravasation of plasma into intercellular spaces and accumulation of white blood cells and macrophages.
	GO:0060548	negative regulation of cell death	Any process that decreases the rate or frequency of cell death. Cell death is the specific activation or halting of processes within a cell so that its vital functions markedly cease, rather than simply deteriorating gradually over time, which culminates in cell death.
	GO:2000352	negative regulation of endothelial cell apoptotic process	Any process that stops, prevents or reduces the frequency, rate or extent of endothelial cell apoptotic process.
	GO:1902037	negative regulation of hematopoietic stem cell differentiation	Any process that stops, prevents or reduces the frequency, rate or extent of hematopoietic stem cell differentiation.
	GO:1903206	negative regulation of hydrogen peroxide-induced cell death	Any process that stops, prevents or reduces the frequency, rate or extent of hydrogen peroxide-induced cell death.
	GO:1902176	negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway	Any process that stops, prevents or reduces the frequency, rate or extent of an oxidative stress-induced intrinsic apoptotic signaling pathway.
	GO:1903071	positive regulation of ER-associated ubiquitin-dependent protein catabolic process	Any process that activates or increases the frequency, rate or extent of ER-associated ubiquitin-dependent protein catabolic process.
	GO:0030194	positive regulation of blood coagulation	Any process that activates or increases the frequency, rate or extent of blood coagulation.
	GO:0010628	positive regulation of gene expression	Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
	GO:0046326	positive regulation of glucose import	Any process that activates or increases the frequency, rate or extent of the import of the hexose monosaccharide glucose into a cell or organelle.
	GO:1903788	positive regulation of glutathione biosynthetic process	Any process that activates or increases the frequency, rate or extent of glutathione biosynthetic process.
	GO:2000379	positive regulation of reactive oxygen species metabolic process	Any process that activates or increases the frequency, rate or extent of reactive oxygen species metabolic process.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0036091	positive regulation of transcription from RNA polymerase II promoter in response to oxidative stress	Any process that increases the frequency, rate or extent of transcription from an RNA polymerase II promoter as a result of a stimulus indicating the organism is under oxidative stress, a state often resulting from exposure to high levels of reactive oxygen species, e.g. superoxide anions, hydrogen peroxide (H2O2), and hydroxyl radicals.
	GO:0036003	positive regulation of transcription from RNA polymerase II promoter in response to stress	Any process that increases the frequency, rate or extent of transcription from an RNA polymerase II promoter as a result of a stimulus indicating the organism is under stress. The stress is usually, but not necessarily, exogenous (e.g. temperature, humidity, ionizing radiation).
	GO:0045893	positive regulation of transcription, DNA-templated	Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0010499	proteasomal ubiquitin-independent protein catabolic process	The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds that is mediated by the proteasome but do not involve ubiquitin.
	GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
	GO:0016567	protein ubiquitination	The process in which one or more ubiquitin groups are added to a protein.
	GO:0045995	regulation of embryonic development	Any process that modulates the frequency, rate or extent of embryonic development.
	GO:2000121	regulation of removal of superoxide radicals	Any process that modulates the frequency, rate or extent of removal of superoxide radicals.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0034976	response to endoplasmic reticulum stress	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stress acting at the endoplasmic reticulum. ER stress usually results from the accumulation of unfolded or misfolded proteins in the ER lumen.
	GO:0006366	transcription from RNA polymerase II promoter	The synthesis of RNA from a DNA template by RNA polymerase II, originating at an RNA polymerase II promoter. Includes transcription of messenger RNA (mRNA) and certain small nuclear RNAs (snRNAs).
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0005813	centrosome	A structure comprised of a core structure (in most organisms, a pair of centrioles) and peripheral material from which a microtubule-based structure, such as a spindle apparatus, is organized. Centrosomes occur close to the nucleus during interphase in many eukaryotic cells, though in animal cells it changes continually during the cell-division cycle.
	GO:0000785	chromatin	The ordered and organized complex of DNA, protein, and sometimes RNA, that forms the chromosome.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0032993	protein-DNA complex	A macromolecular complex containing both protein and DNA molecules.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		ACT	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3zgc)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3zgc
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	KEAP1_HUMAN \| Q14145
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	NF2L2_HUMAN \| Q16236
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	KEAP1_HUMAN \| Q14145
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	NF2L2_HUMAN \| Q16236
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

3zgd	CRYSTAL STRUCTURE OF A KEAP1 MUTANT

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 10)

Sites (10, 10)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (6, 12)

PROSITE Motifs (0, 0)

Exons (5, 9)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (80, 88)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File