|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (4, 5)| Asymmetric Unit (4, 5) Biological Unit 1 (2, 6) |
Sites (5, 5)
Asymmetric Unit (5, 5)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3ZEZ) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3ZEZ) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3ZEZ) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3ZEZ) |
Exons (0, 0)| (no "Exon" information available for 3ZEZ) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:169 aligned with A4ZF98_9CAUD | A4ZF98 from UniProtKB/TrEMBL Length:170 Alignment length:169 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 A4ZF98_9CAUD 2 TNTLQVKLLSKNARMPERNHKTDAGYDIFSAETVVLEPQEKAVIKTDVAVSIPEGYVGLLTSRSGVSSKTHLVIETGKIDAGYHGNLGINIKNDHEDDKMQTIFLRNIDNEKIFEKERHLYKLGSYRIEKGERIAQLVIVPIWTPELKQVEEFESVSERGEKGFGSSGV 170 SCOP domains d3zeza_ A: automated matches SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 3zez A 2 TNTLQVKLLSKNARMPERNHKTDAGYDIFSAETVVLEPQEKAVIKTDVAVSIPEGYVGLLTSRSGVSSKTHLVIETGKIDAGYHGNLGINIKNDHEDDKMQTIFLRNIDNEKIFEKERHLYKLGSYRIEKGERIAQLVIVPIWTPELKQVEEFESVSERGEKGFGSSGV 170 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3ZEZ) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3ZEZ) |
Gene Ontology (2, 2)|
Asymmetric Unit(hide GO term definitions) Chain A (A4ZF98_9CAUD | A4ZF98)
|
||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|