Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF METAGENOME-DERIVED GLYCOSIDE HYDROLASE FAMILY 12 ENDOGLUCANASE
 
Authors :  H. Okano, C. Angkawidjaja, S. Kanaya
Date :  17 Jul 14  (Deposition) - 12 Nov 14  (Release) - 21 Jan 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.85
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Glycoside Hydrolase Family 12 Endoglucanase, Cellulase, Carbohydrate Binding, Sugar Binding, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  H. Okano, M. Ozaki, E. Kanaya, J. J. Kim, C. Angkawidjaja, Y. Koga, S. Kanaya
Structure And Stability Of Metagenome-Derived Glycoside Hydrolase Family 12 Cellulase (Lc-Cela) A Homolog Of Cel12A From Rhodothermus Marinus
Febs Open Bio V. 4 936 2014
PubMed-ID: 25426413  |  Reference-DOI: 10.1016/J.FOB.2014.10.013

(-) Compounds

Molecule 1 - CELLULASE
    Chains: A, B
    EC Number: 3.2.1.4
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PET25B
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Fragment: UNP RESIDUES 20-261
    Organism Scientific: UNCULTURED BACTERIUM
    Organism Taxid: 77133
    Synonym: LC-CELA

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3WX5)

(-) Sites  (0, 0)

(no "Site" information available for 3WX5)

(-) SS Bonds  (4, 4)

Asymmetric Unit
No.Residues
1A:40 -A:67
2A:100 -A:105
3B:40 -B:67
4B:100 -B:105

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Leu A:111 -Pro A:112
2Leu B:111 -Pro B:112

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3WX5)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3WX5)

(-) Exons   (0, 0)

(no "Exon" information available for 3WX5)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:229
 aligned with W8PWF3_9BACT | W8PWF3 from UniProtKB/TrEMBL  Length:261

    Alignment length:229
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252         
         W8PWF3_9BACT    33 DEPTATVCDRWGSRDVAGGRYRVINNVWGAETAQCIEIGLETGNFILTRAEHSNGDNVAAYPAIYLGCHWGACTSQSGLPLRVEAISRLQSNWRLTPISSGRWNAAYDLWFSPSLTSTNGYSGGAELMIWLNWRGNVMPGGNRVATVSLAGATWEVWFADWDWNYIAYRRTTPVTEVTQLDLKAFIDDAVARGYISPTWYLHAVETGFELWEGGRGLKSSDFSVTLTAR 261
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee.....eeeehhhheeee.........eeeeee.....eeeeee............eeeeeee..ee.......ee...eeeeeeeeeee.....eeeeeeeeeee............eeeeeeeeee.......eeeeeeee..eeeeeeeee...eeeeeee.....eeeeeehhhhhhhhhhh.......eeeeeeee..eee.....eeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3wx5 A  33 DEPTATVCDRWGSRDVAGGRYRVINNVWGAETAQCIEIGLETGNFILTRAEHSNGDNVAAYPAIYLGCHWGACTSQSGLPLRVEAISRLQSNWRLTPISSGRWNAAYDLWFSPSLTSTNGYSGGAELMIWLNWRGNVMPGGNRVATVSLAGATWEVWFADWDWNYIAYRRTTPVTEVTQLDLKAFIDDAVARGYISPTWYLHAVETGFELWEGGRGLKSSDFSVTLTAR 261
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252         


Chain B from PDB  Type:PROTEIN  Length:229
 aligned with W8PWF3_9BACT | W8PWF3 from UniProtKB/TrEMBL  Length:261

    Alignment length:229
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252         
         W8PWF3_9BACT    33 DEPTATVCDRWGSRDVAGGRYRVINNVWGAETAQCIEIGLETGNFILTRAEHSNGDNVAAYPAIYLGCHWGACTSQSGLPLRVEAISRLQSNWRLTPISSGRWNAAYDLWFSPSLTSTNGYSGGAELMIWLNWRGNVMPGGNRVATVSLAGATWEVWFADWDWNYIAYRRTTPVTEVTQLDLKAFIDDAVARGYISPTWYLHAVETGFELWEGGRGLKSSDFSVTLTAR 261
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee.....eeeehhhheeee.........eeeeee.....eeeeee............eeeeeee..ee.......ee...eeeeeeeeeee.....eeeeeeeeeee............eeeeeeeeee.......eeeeeeee..eeeeeeeee...eeeeeee.....eeeeeehhhhhhhhhhh.......eeeeeeee..eee.....eeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3wx5 B  33 DEPTATVCDRWGSRDVAGGRYRVINNVWGAETAQCIEIGLETGNFILTRAEHSNGDNVAAYPAIYLGCHWGACTSQSGLPLRVEAISRLQSNWRLTPISSGRWNAAYDLWFSPSLTSTNGYSGGAELMIWLNWRGNVMPGGNRVATVSLAGATWEVWFADWDWNYIAYRRTTPVTEVTQLDLKAFIDDAVARGYISPTWYLHAVETGFELWEGGRGLKSSDFSVTLTAR 261
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3WX5)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3WX5)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3WX5)

(-) Gene Ontology  (7, 7)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (W8PWF3_9BACT | W8PWF3)
molecular function
    GO:0008810    cellulase activity    Catalysis of the endohydrolysis of (1->4)-beta-D-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0016798    hydrolase activity, acting on glycosyl bonds    Catalysis of the hydrolysis of any glycosyl bond.
    GO:0004553    hydrolase activity, hydrolyzing O-glycosyl compounds    Catalysis of the hydrolysis of any O-glycosyl bond.
biological process
    GO:0005975    carbohydrate metabolic process    The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
    GO:0000272    polysaccharide catabolic process    The chemical reactions and pathways resulting in the breakdown of a polysaccharide, a polymer of many (typically more than 10) monosaccharide residues linked glycosidically.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3wx5)
 
  Sites
(no "Sites" information available for 3wx5)
 
  Cis Peptide Bonds
    Leu A:111 - Pro A:112   [ RasMol ]  
    Leu B:111 - Pro B:112   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3wx5
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  W8PWF3_9BACT | W8PWF3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  3.2.1.4
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  W8PWF3_9BACT | W8PWF3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3WX5)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3WX5)