Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE LAMPREY VARIABLE LYMPHOCYTE RECEPTOR C
 
Authors :  R. Kanda, Y. Sutoh, J. Kasamatsu, K. Maenaka, M. Kasahara, T. Ose
Date :  20 Dec 13  (Deposition) - 05 Mar 14  (Release) - 05 Mar 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym./Biol. Unit :  A
Keywords :  Leucine Rich Repeat, Immunological Receptor, Membrane, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  R. Kanda, Y. Sutoh, J. Kasamatsu, K. Maenaka, M. Kasahara, T. Ose
Crystal Structure Of The Lamprey Variable Lymphocyte Receptor C Reveals An Unusual Feature In Its N-Terminal Capping Module.
Plos One V. 9 85875 2014
PubMed-ID: 24465760  |  Reference-DOI: 10.1371/JOURNAL.PONE.0085875

(-) Compounds

Molecule 1 - VARIABLE LYMPHOCYTE RECEPTOR C
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET-26(B)
    Expression System StrainC43(DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentVLRC ECTODOMAIN, UNP RESIDUES 25-246
    GeneVLRC
    Organism CommonJAPANESE LAMPREY
    Organism ScientificLETHENTERON CAMTSCHATICUM
    Organism Taxid980415

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3WO9)

(-) Sites  (0, 0)

(no "Site" information available for 3WO9)

(-) SS Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1A:28 -A:39
2A:37 -A:52
3A:200 -A:227
4A:202 -A:247

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3WO9)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3WO9)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3WO9)

(-) Exons   (0, 0)

(no "Exon" information available for 3WO9)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:223
 aligned with E0D2V6_LETCA | E0D2V6 from UniProtKB/TrEMBL  Length:320

    Alignment length:223
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242   
         E0D2V6_LETCA    23 RRACLAVGKDDICTCSNKTDSSPETVDCSSKKLTAVPTGIPANTEKLQLDFNQLANIPAEAFHGLTRLTYLALDYNQLQSLPVGVFDQLNNLNELRLQDNQLTSLPPGVFDSLTKLTYLTLSQNQLQSIPAGVFDKLTNLNRLELSTNQLQSVPHGAFDSLVNLETLHLELNPWDCACSDIIYLRTFIAKNTDKISGMESAQCNGTSTAVKDVNTEKIKNVTC 245
               SCOP domains d3wo9a_ A: automated matches                                                                                                                                                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eee..ee...eee........eee..................eee.....................eee.....................eee.....................eee.....................eee.....................eee...........hhhhhhhhhhhhh................hhhhh.......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3wo9 A  25 HMACLAVGKDDICTCSNKTDSSPETVDCSSKKLTAVPTGIPANTEKLQLDFNQLANIPAEAFHGLTRLTYLALDYNQLQSLPVGVFDQLNNLNELRLQDNQLTSLPPGVFDSLTKLTYLTLSQNQLQSIPAGVFDKLTNLNRLELSTNQLQSVPHGAFDSLVNLETLHLELNPWDCACSDIIYLRTFIAKNTDKISGMESAQCNGTSTAVKDVNTEKIKNVTC 247
                                    34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3WO9)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3WO9)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (E0D2V6_LETCA | E0D2V6)
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3wo9)
 
  Sites
(no "Sites" information available for 3wo9)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3wo9)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3wo9
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  E0D2V6_LETCA | E0D2V6
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  E0D2V6_LETCA | E0D2V6
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3WO9)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3WO9)