Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  THE STRUCTURE OF AN ANTI-CANCER LECTIN MYTILEC WITH LIGAND FROM THE MUSSEL MYTILUS GALLOPROVINCIALIS
 
Authors :  D. Terada, F. Kawai, H. Noguchi, S. Unzai, S. -Y. Park, Y. Ozeki, J. R. H. T
Date :  27 Nov 13  (Deposition) - 03 Dec 14  (Release) - 07 Jun 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.05
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Sugar Binding Protein, Lectin, Carbohydrate (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  D. Terada, F. Kawai, H. Noguchi, S. Unzai, I. Hasan, Y. Fujii, S. -Y. Park, Y. Ozeki, J. R. H. Tame
Crystal Structure Of Mytilec, A Galactose-Binding Lectin From The Mussel Mytilus Galloprovincialis With Cytotoxicity Against Certain Cancer Cell Types
Sci Rep V. 6 28344 2016
PubMed-ID: 27321048  |  Reference-DOI: 10.1038/SREP28344

(-) Compounds

Molecule 1 - LECTIN
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    MutationYES
    Organism CommonMEDITERRANEAN MUSSEL
    Organism ScientificMYTILUS GALLOPROVINCIALIS
    Organism Taxid29158
    SynonymMYTILEC

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 6)

Asymmetric/Biological Unit (1, 6)
No.NameCountTypeFull Name
1A2G6Ligand/IonN-ACETYL-2-DEOXY-2-AMINO-GALACTOSE

(-) Sites  (6, 6)

Asymmetric Unit (6, 6)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLU A:74 , GLN A:81 , ARG A:83 , HIS A:107 , PRO A:108 , LYS A:109 , GLY A:110 , GLY A:111 , VAL A:122 , HIS A:124 , ASP A:126 , HIS A:128 , HOH A:324 , HOH A:387BINDING SITE FOR RESIDUE A2G A 201
2AC2SOFTWAREHIS A:15 , PRO A:16 , LYS A:17 , GLY A:18 , GLY A:19 , HIS A:32 , ASP A:34 , HIS A:36 , ARG A:38 , GLU A:118 , HOH A:389 , HOH A:407BINDING SITE FOR RESIDUE A2G A 202
3AC3SOFTWAREASP A:26 , HIS A:63 , PRO A:64 , LEU A:65 , GLY A:66 , GLY A:67 , VAL A:78 , HIS A:80 , ASP A:82 , HIS A:84 , ARG A:86 , HOH A:346 , HOH A:372 , HOH A:401 , ALA B:9 , SER B:10BINDING SITE FOR RESIDUE A2G A 203
4AC4SOFTWAREHIS B:15 , PRO B:16 , LYS B:17 , GLY B:18 , GLY B:19 , ASP B:34 , HIS B:36 , ARG B:38 , GLU B:118 , HOH B:335 , HOH B:359 , HOH B:406BINDING SITE FOR RESIDUE A2G B 201
5AC5SOFTWARELYS A:139 , HOH A:333 , ASP B:26 , HIS B:63 , LEU B:65 , GLY B:66 , GLY B:67 , VAL B:78 , HIS B:80 , ASP B:82 , HIS B:84 , HOH B:376 , HOH B:395 , HOH B:402BINDING SITE FOR RESIDUE A2G B 202
6AC6SOFTWAREGLU B:74 , HIS B:107 , PRO B:108 , LYS B:109 , GLY B:110 , GLY B:111 , VAL B:122 , HIS B:124 , ASP B:126 , HIS B:128 , HOH B:401BINDING SITE FOR RESIDUE A2G B 203

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3WMV)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3WMV)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3WMV)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3WMV)

(-) Exons   (0, 0)

(no "Exon" information available for 3WMV)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:150
 aligned with LEC_MYTGA | B3EWR1 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:150
                             1                                                                                                                                                    
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149
            LEC_MYTGA     - -TTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYVHPKGGSTNPPNETLTVMHGDKHGAMEFIFVSPKNKDKRVLVYV 149
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....eeee.....eeee..........eeeeee...hhhh.eeeeeee..eeeeee.....eeee............eeee...hhhh.eeee....eeee....eeee..........eeeeee...hhhh.eeeee..eeeee..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3wmv A   0 MATFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYVHPKGGSTNPPNETLTVMHGDKHGAMEFIFVSPKNKDKRVLVYV 149
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149

Chain B from PDB  Type:PROTEIN  Length:149
 aligned with LEC_MYTGA | B3EWR1 from UniProtKB/Swiss-Prot  Length:149

    Alignment length:149
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140         
            LEC_MYTGA     1 TTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYVHPKGGSTNPPNETLTVMHGDKHGAMEFIFVSPKNKDKRVLVYV 149
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee.....eeee..........eeeeee...hhhh.eeeeeee..eeeeee.....eeee............eeee...hhhh.eeee....eeee....eeee..........eeeeee...hhhh.eeeee..eeeee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3wmv B   1 ATFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYVHPKGGSTNPPNETLTVMHGDKHGAMEFIFVSPKNKDKRVLVYV 149
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3WMV)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3WMV)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3WMV)

(-) Gene Ontology  (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (LEC_MYTGA | B3EWR1)
molecular function
    GO:0030246    carbohydrate binding    Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
    GO:0005534    galactose binding    Interacting selectively and non-covalently with the aldohexose galactose (galacto-hexose), a common constituent of many oligo- and polysaccharides.
biological process
    GO:0031640    killing of cells of other organism    Any process in an organism that results in the killing of cells of another organism, including in some cases the death of the other organism. Killing here refers to the induction of death in one cell by another cell, not cell-autonomous death due to internal or other environmental conditions.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    A2G  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3wmv)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3wmv
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  LEC_MYTGA | B3EWR1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  LEC_MYTGA | B3EWR1
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        LEC_MYTGA | B3EWR13wmu

(-) Related Entries Specified in the PDB File

3wmu