Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  THE CRYSTAL STRUCTURE OF HUMAN CYTOSOLIC NADP(+)-DEPENDENT MALIC ENZYME IN APO FORM
 
Authors :  S. -Y. Li, M. -C. Chen, P. -C. Yang, N. -L. Chan, J. -H. Liu, H. -C. Hung
Date :  08 Oct 13  (Deposition) - 13 Aug 14  (Release) - 13 Aug 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.55
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (2x)
Keywords :  Nadp(+)-Binding Rossmann-Fold Domains, Oxidoreductase Activity, Metal Ion Binding, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Y. Hsieh, S. -Y. Li, M. -C. Chen, P. -C. Yang, H. -Y. Chen, N. -L. Chan, J. -H. Liu, H. -C. Hung
Structural Characteristics Of The Nonallosteric Human Cytosolic Malic Enzyme
Biochim. Biophys. Acta 2014
PubMed-ID: 24998673  |  Reference-DOI: 10.1016/J.BBAPAP.2014.06.019

(-) Compounds

Molecule 1 - NADP-DEPENDENT MALIC ENZYME
    Chains: A, B
    EC Number: 1.1.1.40
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET21B
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: ME1
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: CYTOSOLIC NADP(+)-DEPENDENT MALIC ENZYME, NADP-ME, MALIC ENZYME 1

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (2x): AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3WJA)

(-) Sites  (0, 0)

(no "Site" information available for 3WJA)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3WJA)

(-) Cis Peptide Bonds  (6, 6)

Asymmetric Unit
No.Residues
1Thr A:113 -Pro A:114
2Asn A:418 -Pro A:419
3Tyr A:540 -Pro A:541
4Thr B:113 -Pro B:114
5Asn B:418 -Pro B:419
6Tyr B:540 -Pro B:541

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3WJA)

(-) PROSITE Motifs  (1, 2)

Asymmetric Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1MALIC_ENZYMESPS00331 Malic enzymes signature.MAOX_HUMAN266-282
 		  2A:276-292
B:276-292
Biological Unit 1 (1, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1MALIC_ENZYMESPS00331 Malic enzymes signature.MAOX_HUMAN266-282
 		  4A:276-292
B:276-292

(-) Exons   (14, 28)

Asymmetric Unit (14, 28)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000003697051ENSE00000760044chr6:84140790-84140596195MAOX_HUMAN1-26262A:18-36
B:18-36		19
19
1.2ENST000003697052ENSE00000531502chr6:84117620-84117487134MAOX_HUMAN27-71452A:37-81
B:37-81		45
45
1.3ENST000003697053ENSE00000760043chr6:84108235-84108086150MAOX_HUMAN71-121512A:81-131
B:81-131		51
51
1.4ENST000003697054ENSE00000760023chr6:84061858-8406178376MAOX_HUMAN121-146262A:131-156
B:131-156		26
26
1.5ENST000003697055ENSE00002200158chr6:84056053-84055892162MAOX_HUMAN147-200542A:157-210
B:157-210		54
54
1.6ENST000003697056ENSE00000760021chr6:84025132-84025029104MAOX_HUMAN201-235352A:211-245
B:211-245		35
35
1.7ENST000003697057ENSE00000760020chr6:83963457-83963348110MAOX_HUMAN235-272382A:245-282
B:245-282		38
38
1.8ENST000003697058ENSE00000760019chr6:83949355-8394925898MAOX_HUMAN272-304332A:282-314
B:282-314		33
33
1.9ENST000003697059ENSE00000760018chr6:83947549-83947436114MAOX_HUMAN305-342382A:315-352
B:315-352		38
38
1.10ENST0000036970510ENSE00000760017chr6:83938650-83938545106MAOX_HUMAN343-378362A:353-388
B:353-388		36
36
1.11ENST0000036970511ENSE00000760016chr6:83937196-83937054143MAOX_HUMAN378-425482A:388-435
B:388-435		48
48
1.12ENST0000036970512ENSE00000760015chr6:83933652-83933479174MAOX_HUMAN426-483582A:436-493
B:436-493		58
58
1.13ENST0000036970513ENSE00000760014chr6:83926315-8392621799MAOX_HUMAN484-516332A:494-526
B:494-526		33
33
1.14ENST0000036970514ENSE00001450687chr6:83921813-839201081706MAOX_HUMAN517-572562A:527-579
B:527-580		53
54

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:562
 aligned with MAOX_HUMAN | P48163 from UniProtKB/Swiss-Prot  Length:572

    Alignment length:562
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477       487       497       507       517       527       537       547       557       567  
           MAOX_HUMAN     8 RRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKPRGLFITIHDRGHIASVLNAWPEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECLPVILDVGTENEELLKDPLYIGLRQRRVRGSEYDDFLDEFMEAVSSKYGMNCLIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEEMKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRSQMYSTDYDQILPDCYSWPEEVQKIQTK 569
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhh.....hhhhhhhhhhhhh...........hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhh..........eeee.hhh.hhhhhhh........eeeee..........hhhhhhhhhhhhhhhhhhhhh.hhh.eeeeeee....hhhhhhh...........hhhhhhhhhhhhhhhhhhhhh...eeee...hhhhhhhhhhhhh....eee..hhhhhhhhhhhhhhhhhhhh.hhhhh.eeee..hhhhhhhhhhhhhhhhhh..hhhhhh..eeeee..ee........hhhhhh.........hhhhhhhhhh..eeee........hhhhhhhhhhhh...eeee...hhhhh..hhhhhhhhhh...eeee......ee.....ee..ee.hhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhh.hhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhh................hhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MALIC_ENZYMES    ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1           Exon 1.2  PDB: A:37-81 UniProt: 27-71        -------------------------------------------------Exon 1.4  PDB: A:131-156  Exon 1.5  PDB: A:157-210 UniProt: 147-200             Exon 1.6  PDB: A:211-245           ------------------------------------Exon 1.8  PDB: A:282-314         Exon 1.9  PDB: A:315-352              Exon 1.10  PDB: A:353-388           -----------------------------------------------Exon 1.12  PDB: A:436-493 UniProt: 426-483                Exon 1.13  PDB: A:494-526        Exon 1.14  PDB: A:527-579 UniProt: 517-572            Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------Exon 1.3  PDB: A:81-131 UniProt: 71-121            -----------------------------------------------------------------------------------------------------------------Exon 1.7  PDB: A:245-282              ---------------------------------------------------------------------------------------------------------Exon 1.11  PDB: A:388-435 UniProt: 378-425      ------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 1 (2)
                 3wja A  18 RRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKPRGLFITIHDRGHIASVLNAWPEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECLPVILDVGTENEELLKDPLYIGLRQRRVRGSEYDDFLDEFMEAVSSKYGMNCLIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEEMKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRSQMYSTDYDQILPDCYSWPEEVQKIQTK 579
                                    27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477       487       497       507       517       527       537       547       557       567       577  


Chain B from PDB  Type:PROTEIN  Length:563
 aligned with MAOX_HUMAN | P48163 from UniProtKB/Swiss-Prot  Length:572

    Alignment length:563
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477       487       497       507       517       527       537       547       557       567   
           MAOX_HUMAN     8 RRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKPRGLFITIHDRGHIASVLNAWPEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECLPVILDVGTENEELLKDPLYIGLRQRRVRGSEYDDFLDEFMEAVSSKYGMNCLIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEEMKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRSQMYSTDYDQILPDCYSWPEEVQKIQTKV 570
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhh.....hhhhhhhhhhhhh...........hhhhhhhhhhhhhhh..hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhh..........eeee.hhh.hhhhhhh........eeeee..........hhhhhhhhhhhhhhhhhhhhh.hhh.eeeeeee....hhhhhh............hhhhhhhhhhhhhhhhhhhhh...eeee...hhhhhhhhhhhhh....eeehhhhhhhhhhhhhhhhhhhhhh.hhhhh.eeee..hhhhhhhhhhhhhhhhhhh.hhhhhhh.eeeee..ee........hhhhhh.........hhhhhhhhhh..eeee........hhhhhhhhhhhh...eeee...hhhhh..hhhhhhhhh....eeee......ee.....ee..ee.hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhh.hhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhh...............hhhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MALIC_ENZYMES    ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.1           Exon 1.2  PDB: B:37-81 UniProt: 27-71        -------------------------------------------------Exon 1.4  PDB: B:131-156  Exon 1.5  PDB: B:157-210 UniProt: 147-200             Exon 1.6  PDB: B:211-245           ------------------------------------Exon 1.8  PDB: B:282-314         Exon 1.9  PDB: B:315-352              Exon 1.10  PDB: B:353-388           -----------------------------------------------Exon 1.12  PDB: B:436-493 UniProt: 426-483                Exon 1.13  PDB: B:494-526        Exon 1.14  PDB: B:527-580 UniProt: 517-572             Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------Exon 1.3  PDB: B:81-131 UniProt: 71-121            -----------------------------------------------------------------------------------------------------------------Exon 1.7  PDB: B:245-282              ---------------------------------------------------------------------------------------------------------Exon 1.11  PDB: B:388-435 UniProt: 378-425      ------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3wja B  18 RRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKPRGLFITIHDRGHIASVLNAWPEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECLPVILDVGTENEELLKDPLYIGLRQRRVRGSEYDDFLDEFMEAVSSKYGMNCLIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEEMKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRSQMYSTDYDQILPDCYSWPEEVQKIQTKV 580
                                    27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477       487       497       507       517       527       537       547       557       567       577
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3WJA)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3WJA)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3WJA)

(-) Gene Ontology  (22, 22)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (MAOX_HUMAN | P48163)
molecular function
    GO:0043531    ADP binding    Interacting selectively and non-covalently with ADP, adenosine 5'-diphosphate.
    GO:0051287    NAD binding    Interacting selectively and non-covalently with nicotinamide adenine dinucleotide, a coenzyme involved in many redox and biosynthetic reactions; binding may be to either the oxidized form, NAD+, or the reduced form, NADH.
    GO:0050661    NADP binding    Interacting selectively and non-covalently with nicotinamide-adenine dinucleotide phosphate, a coenzyme involved in many redox and biosynthetic reactions; binding may be to either the oxidized form, NADP+, or the reduced form, NADPH.
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0004471    malate dehydrogenase (decarboxylating) (NAD+) activity    Catalysis of the reaction: (S)-malate + NAD+ = pyruvate + CO2 + NADH + H+.
    GO:0004473    malate dehydrogenase (decarboxylating) (NADP+) activity    Catalysis of the reaction: (S)-malate + NADP+ = pyruvate + CO2 + NADPH + H+.
    GO:0004470    malic enzyme activity    Catalysis of the oxidative decarboxylation of malate with the concomitant production of pyruvate.
    GO:0030145    manganese ion binding    Interacting selectively and non-covalently with manganese (Mn) ions.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0008948    oxaloacetate decarboxylase activity    Catalysis of the reaction: oxaloacetate = pyruvate + CO2.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
    GO:0006741    NADP biosynthetic process    The chemical reactions and pathways resulting in the formation of nicotinamide-adenine dinucleotide phosphate, a coenzyme involved in many redox and biosynthetic reactions; biosynthesis may be of either the oxidized form, NADP, or the reduced form, NADPH.
    GO:0005975    carbohydrate metabolic process    The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
    GO:0006108    malate metabolic process    The chemical reactions and pathways involving malate, the anion of hydroxybutanedioic acid, a chiral hydroxydicarboxylic acid. The (+) enantiomer is an important intermediate in metabolism as a component of both the TCA cycle and the glyoxylate cycle.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0051262    protein tetramerization    The formation of a protein tetramer, a macromolecular structure consisting of four noncovalently associated identical or nonidentical subunits.
    GO:1902031    regulation of NADP metabolic process    Any process that modulates the frequency, rate or extent of NADP metabolic process.
    GO:0009743    response to carbohydrate    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a carbohydrate stimulus.
    GO:0009725    response to hormone    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a hormone stimulus.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3wja)
 
  Sites
(no "Sites" information available for 3wja)
 
  Cis Peptide Bonds
    Asn A:418 - Pro A:419   [ RasMol ]  
    Asn B:418 - Pro B:419   [ RasMol ]  
    Thr A:113 - Pro A:114   [ RasMol ]  
    Thr B:113 - Pro B:114   [ RasMol ]  
    Tyr A:540 - Pro A:541   [ RasMol ]  
    Tyr B:540 - Pro B:541   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3wja
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MAOX_HUMAN | P48163
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.1.1.40
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  MAOX_HUMAN | P48163
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        MAOX_HUMAN | P48163: 2aw5

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3WJA)