Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF AGROCYBE CYLINDRACEA GALECTIN WITH BLOOD TYPE A ANTIGEN TETRAOSE
 
Authors :  N. Kuwabara, D. Hu, H. Tateno, H. Makio, J. Hirabayashi, R. Kato
Date :  25 Jul 13  (Deposition) - 27 Nov 13  (Release) - 27 Nov 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.35
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Galectin, Galactose Binding, Sugar Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  N. Kuwabara, D. Hu, H. Tateno, H. Makyio, J. Hirabayashi, R. Kato
Conformational Change Of A Unique Sequence In A Fungal Galectin From Agrocybe Cylindracea Controls Glycan Ligand-Binding Specificity.
Febs Lett. V. 587 3620 2013
PubMed-ID: 24036446  |  Reference-DOI: 10.1016/J.FEBSLET.2013.08.046

(-) Compounds

Molecule 1 - GALACTOSIDE-BINDING LECTIN
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET27B
    Expression System StrainBL21(DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    Organism ScientificAGROCYBE CYLINDRACEA
    Organism Taxid64608

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (6, 10)

Asymmetric/Biological Unit (6, 10)
No.NameCountTypeFull Name
1A2G2Ligand/IonN-ACETYL-2-DEOXY-2-AMINO-GALACTOSE
2EDO1Ligand/Ion1,2-ETHANEDIOL
3FUC2Ligand/IonALPHA-L-FUCOSE
4GAL2Ligand/IonBETA-D-GALACTOSE
5NAG2Ligand/IonN-ACETYL-D-GLUCOSAMINE
6PEG1Ligand/IonDI(HYDROXYETHYL)ETHER

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREALA A:13 , GLY A:14 , SER A:141 , GLU A:143 , HOH A:344 , HOH A:362 , HOH A:381 , HOH B:385BINDING SITE FOR RESIDUE EDO A 201
2AC2SOFTWAREPHE A:32 , GLU A:153 , HOH A:431 , PHE B:32 , GLU B:153 , HOH B:466BINDING SITE FOR RESIDUE PEG B 201
3AC3SOFTWAREASN A:47 , ALA A:49 , HIS A:62 , ARG A:66 , ASN A:75 , TRP A:83 , GLU A:86 , ARG A:88 , ASN A:140 , HOH A:303 , HOH A:317 , HOH A:322 , HOH A:327 , HOH A:331 , HOH A:342 , HOH A:349 , HOH A:361 , HOH A:368 , HOH A:388 , HOH A:392 , HOH A:408 , HOH A:462 , HOH A:463 , HOH A:526 , SER B:12 , GLY B:14 , ASN B:80 , HOH B:308 , HOH B:380 , HOH B:459BINDING SITE FOR CHAIN A OF POLYSACCHARIDE RESIDUES 202 TO 205
4AC4SOFTWARESER A:12 , ASN A:80 , HOH A:343 , HOH A:381 , HOH A:407 , ALA B:49 , HIS B:62 , ARG B:66 , ASN B:75 , ARG B:77 , TRP B:83 , GLU B:86 , ARG B:88 , ASN B:140 , HOH B:301 , HOH B:315 , HOH B:325 , HOH B:336 , HOH B:358 , HOH B:384 , HOH B:385 , HOH B:397 , HOH B:451 , HOH B:452 , HOH B:453 , HOH B:465BINDING SITE FOR CHAIN B OF POLYSACCHARIDE RESIDUES 202 TO 205

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3WG3)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3WG3)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3WG3)

(-) PROSITE Motifs  (1, 2)

Asymmetric/Biological Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1GALECTINPS51304 Galactoside-binding lectin (galectin) domain profile.ATLE_AGRAE12-155
 
  2A:16-158
B:16-158

(-) Exons   (0, 0)

(no "Exon" information available for 3WG3)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:163
 aligned with ATLE_AGRAE | Q6WY08 from UniProtKB/Swiss-Prot  Length:158

    Alignment length:163
                                 1                                                                                                                                                             
                                 |   5        15        25        35        45        55        65        75        85        95       105       115       125       135       145       155   
           ATLE_AGRAE     - -----QGVNIYNISAGTSVDLAAPVTTGDIVTFFSSALNLNAGAGNPNNTTLNLFAENGAYLLHIAFRLQENVIIFNSRQPDGPWLVEQRVSDVANQFAGIDGKAMVTVFDHGDKYQVVINEKTVIQYTKQISGLTLSLSYNATEETSIFSTVVEAVTYTGLA 158
               SCOP domains d3wg3a_ A: automated matches                                                                                                                                        SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeeeeee..eeeeeeeee....eeeeee..............eeeeee.....eeeeeeee....eeeeeee.........eeee.hhhhhh.....eeeeeee...eeeeee..eeeeeee......eeeeeee..........eeeeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------GALECTIN  PDB: A:16-158 UniProt: 12-155                                                                                                         --- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3wg3 A  -1 KHMTTSAVNIYNISAGASVDLAAPVTTGDIVTFFSSALNLSAGAGSPNNTALNLLSENGAYLLHIAFRLQENVIVFNSRQPNAPWLVEQRVSNVANQFIGSGGKAMVTVFDHGDKYQVVINEKTVIQYTKQISGTTSSLSYNSTEGTSIFSTVVEAVTYTGLA 161
                                     8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158   

Chain B from PDB  Type:PROTEIN  Length:155
 aligned with ATLE_AGRAE | Q6WY08 from UniProtKB/Swiss-Prot  Length:158

    Alignment length:162
                                1                                                                                                                                                             
                                |    6        16        26        36        46        56        66        76        86        96       106       116       126       136       146       156  
           ATLE_AGRAE     - ----QGVNIYNISAGTSVDLAAPVTTGDIVTFFSSALNLNAGAGNPNNTTLNLFAENGAYLLHIAFRLQENVIIFNSRQPDGPWLVEQRVSDVANQFAGIDGKAMVTVFDHGDKYQVVINEKTVIQYTKQISGLTLSLSYNATEETSIFSTVVEAVTYTGLA 158
               SCOP domains d3wg3b_ B: automated matches                                                                                                                                       SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....eeeeeeee..eeeeeeeee....eeeeee.....------...eeeeee.....eeeeeeee....eeeeeee.........eeee.hhhhhh.....eeeeeee...eeeeee..eeeeeee......eeeeeeee.-.......eeeeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ---------------GALECTIN  PDB: B:16-158 UniProt: 12-155                                                                                                         --- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3wg3 B   0 HMTTSAVNIYNISAGASVDLAAPVTTGDIVTFFSSALNL------PNNTALNLLSENGAYLLHIAFRLQENVIVFNSRQPNAPWLVEQRVSNVANQFIGSGGKAMVTVFDHGDKYQVVINEKTVIQYTKQISGTTSSLSYNST-GTSIFSTVVEAVTYTGLA 161
                                     9        19        29        |-     |  49        59        69        79        89        99       109       119       129       139  | |  149       159  
                                                                 38     45                                                                                              142 |                 
                                                                                                                                                                          144                 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3WG3)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3WG3)

(-) Gene Ontology  (10, 10)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (ATLE_AGRAE | Q6WY08)
molecular function
    GO:0030246    carbohydrate binding    Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
    GO:0004536    deoxyribonuclease activity    Catalysis of the hydrolysis of ester linkages within deoxyribonucleic acid.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0004518    nuclease activity    Catalysis of the hydrolysis of ester linkages within nucleic acids.
    GO:0030247    polysaccharide binding    Interacting selectively and non-covalently with any polysaccharide, a polymer of many (typically more than 10) monosaccharide residues linked glycosidically.
biological process
    GO:0006259    DNA metabolic process    Any cellular metabolic process involving deoxyribonucleic acid. This is one of the two main types of nucleic acid, consisting of a long, unbranched macromolecule formed from one, or more commonly, two, strands of linked deoxyribonucleotides.
    GO:0006915    apoptotic process    A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
    GO:0090305    nucleic acid phosphodiester bond hydrolysis    The nucleic acid metabolic process in which the phosphodiester bonds between nucleotides are cleaved by hydrolysis.
    GO:0043065    positive regulation of apoptotic process    Any process that activates or increases the frequency, rate or extent of cell death by apoptotic process.
cellular component
    GO:0005575    cellular_component    The part of a cell, extracellular environment or virus in which a gene product is located. A gene product may be located in one or more parts of a cell and its location may be as specific as a particular macromolecular complex, that is, a stable, persistent association of macromolecules that function together.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    A2G  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FUC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GAL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PEG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3wg3)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3wg3
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ATLE_AGRAE | Q6WY08
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ATLE_AGRAE | Q6WY08
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ATLE_AGRAE | Q6WY081ww4 1ww5 1ww6 1ww7 2zgk 2zgl 2zgm 2zgn 2zgo 2zgp 2zgq 2zgr 2zgs 2zgt 2zgu 3afk 3m3c 3m3e 3m3o 3m3q 3wg1 3wg2 3wg4

(-) Related Entries Specified in the PDB File

3wg1 3wg2 3wg4