Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF P450 RAUA (CYP1050A1) COMPLEXED WITH A BIOSYNTHETIC INTERMEDIATE OF AURACHIN RE
 
Authors :  Y. Yasutake, W. Kitagawa, T. Tamura
Date :  03 Jul 13  (Deposition) - 01 Jan 14  (Release) - 01 Jan 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.19
Chains :  Asym./Biol. Unit :  A
Keywords :  P450 Fold, Monooxygenase (Hydroxylase), Heme, Cytosolic Enzyme, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Y. Yasutake, W. Kitagawa, M. Hata, T. Nishioka, T. Ozaki, M. Nishiyama T. Kuzuyama, T. Tamura
Structure Of The Quinoline N-Hydroxylating Cytochrome P450 Raua, An Essential Enzyme That Confers Antibiotic Activity On Aurachin Alkaloids
Febs Lett. V. 588 105 2014
PubMed-ID: 24269679  |  Reference-DOI: 10.1016/J.FEBSLET.2013.11.016

(-) Compounds

Molecule 1 - CYTOCHROME P450
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET26
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: RAUA
    Organism Scientific: RHODOCOCCUS ERYTHROPOLIS
    Organism Taxid: 1833
    Strain: JCM 6824

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 2)

Asymmetric/Biological Unit (2, 2)
No.NameCountTypeFull Name
1AUI1Ligand/Ion3-[(2E,6E,9R)-9-HYDROXY-3,7,11-TRIMETHYLDODECA-2,6,10-TRIEN-1-YL]-2-METHYLQUINOLIN-4(1H)-ONE
2HEM1Ligand/IonPROTOPORPHYRIN IX CONTAINING FE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELYS A:66 , MET A:101 , HIS A:108 , ARG A:112 , PHE A:119 , ALA A:253 , GLY A:254 , THR A:257 , THR A:258 , PRO A:299 , ARG A:305 , SER A:353 , TYR A:354 , GLY A:355 , HIS A:359 , CYS A:361 , GLY A:363 , ALA A:367 , AUI A:502 , HOH A:601BINDING SITE FOR RESIDUE HEM A 501
2AC2SOFTWARELYS A:66 , PHE A:68 , PHE A:100 , LEU A:102 , LEU A:186 , ASP A:187 , LEU A:249 , ALA A:253 , GLU A:302 , GLY A:304 , GLY A:398 , LEU A:399 , HEM A:501 , HOH A:601BINDING SITE FOR RESIDUE AUI A 502

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3WEC)

(-) Cis Peptide Bonds  (3, 3)

Asymmetric/Biological Unit
No.Residues
1Pro A:17 -Phe A:18
2Pro A:105 -Pro A:106
3Glu A:389 -Pro A:390

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3WEC)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3WEC)

(-) Exons   (0, 0)

(no "Exon" information available for 3WEC)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:401
 aligned with S6BVH1_RHOER | S6BVH1 from UniProtKB/TrEMBL  Length:411

    Alignment length:401
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410 
         S6BVH1_RHOER    11 LALAVNPFDPTFKADPYPVYARLRTELPIHRSALGAWIVADYTSCDKVLRSRLFGKDFANSTFFDHLTSMMGEDMPPFLGLGIDGDARPFMLTDPPEHTRLRGLVSDAFTRSTTTSMDDIVLSAASSAVRHLEHCTDAVSEVAEPFPVEVLSSILGIPDKDRGRFSEWSNLVAGVLDINFAIPKEVADRRSAAIEESIDYFRTLATSGNAPEGLVRRLSEVSHGGDQLSVDEIAATCLLITVAGQETTSNTIGNMLITFSRHADQFEQVRANPQFIENAVAEVLRFEPPAHEAGRIALEDCEVSGANITKGDAVMVLLASGNREAVERGDTFSVTRPDVSSLSYGRGIHHCLGSALANSMLQHFLRELSQRYRSIEVAEPINYKPGMGLRGPETLSVAVSR 411
               SCOP domains d3weca_ A: automated matches                                                                                                                                                                                                                                                                                                                                                                                      SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...............hhhhhhhhhhhh.eee.....eee.hhhhhhhhhhh..ee.hhhhhhhhhhhhhhhh..............hhhhh....hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh.hhhhhh.hhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh.....eeeee...ee....ee....eeeehhhhhhhh............................hhhhhhhhhhhhhhhhhhhh.eeee...................eeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3wec A  11 LALAVNPFDPTFKADPYPVYARLRTELPIHRSALGAWIVADYTSCDKVLRSRLFGKDFANSTFFDHLTSMMGEDMPPFLGLGIDGDARPFMLTDPPEHTRLRGLVSDAFTRSTTTSMDDIVLSAASSAVRHLEHCTDAVSEVAEPFPVEVLSSILGIPDKDRGRFSEWSNLVAGVLDINFAIPKEVADRRSAAIEESIDYFRTLATSGNAPEGLVRRLSEVSHGGDQLSVDEIAATCLLITVAGQETTSNTIGNMLITFSRHADQFEQVRANPQFIENAVAEVLRFEPPAHEAGRIALEDCEVSGANITKGDAVMVLLASGNREAVERGDTFSVTRPDVSSLSYGRGIHHCLGSALANSMLQHFLRELSQRYRSIEVAEPINYKPGMGLRGPETLSVAVSR 411
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3WEC)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3WEC)

(-) Gene Ontology  (7, 7)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (S6BVH1_RHOER | S6BVH1)
molecular function
    GO:0020037    heme binding    Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
    GO:0005506    iron ion binding    Interacting selectively and non-covalently with iron (Fe) ions.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0004497    monooxygenase activity    Catalysis of the incorporation of one atom from molecular oxygen into a compound and the reduction of the other atom of oxygen to water.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0016705    oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen    Catalysis of an oxidation-reduction (redox) reaction in which hydrogen or electrons are transferred from each of two donors, and molecular oxygen is reduced or incorporated into a donor.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    AUI  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    HEM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Glu A:389 - Pro A:390   [ RasMol ]  
    Pro A:105 - Pro A:106   [ RasMol ]  
    Pro A:17 - Phe A:18   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3wec
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  S6BVH1_RHOER | S6BVH1
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  S6BVH1_RHOER | S6BVH1
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3WEC)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3WEC)