|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
Asymmetric/Biological Unit (1, 2)
|
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3WDN) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3WDN) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3WDN) |
PROSITE Motifs (2, 2)
Asymmetric/Biological Unit (2, 2)
|
||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 3WDN) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:125 aligned with GCSH_BOVIN | P20821 from UniProtKB/Swiss-Prot Length:173 Alignment length:125 58 68 78 88 98 108 118 128 138 148 158 168 GCSH_BOVIN 49 SVRKFTEKHEWVTTENGVGTVGISNFAQEALGDVVYCSLPEVGTKLNKQEEFGALESVKAASELYSPLSGEVTEINKALAENPGLVNKSCYEDGWLIKMTFSNPSELDELMSEEAYEKYIKSIEE 173 SCOP domains d3wdna_ A: automated matches SCOP domains CATH domains ----------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -----------------BIOTINYL_LIPOYL PDB: A:18-100 UniProt: 66-148 ------------------------- PROSITE (1) PROSITE (2) ------------------------------------------LIPOYL PDB: A:43-72 ----------------------------------------------------- PROSITE (2) Transcript ----------------------------------------------------------------------------------------------------------------------------- Transcript 3wdn A 1 SVRKFTEKHEWVTTENGVGTVGISNFAQEALGDVVYCSLPEVGTKLNKQEEFGALESVKAASELYSPLSGEVTEINKALAENPGLVNKSCYEDGWLIKMTFSNPSELDELMSEEAYEKYIKSIEE 125 10 20 30 40 50 60 70 80 90 100 110 120
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3WDN) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3WDN) |
Gene Ontology (3, 3)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (GCSH_BOVIN | P20821)
|
||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|