Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF VIGNA UNGUICULATA CHITINASE WITH REGULATION ACTIVITY OF THE PLANT CELL WALL
 
Authors :  K. Morohashi, K. Sasaki, N. Sakabe, K. Sakabe
Date :  20 Dec 12  (Deposition) - 16 Jan 13  (Release) - 16 Jan 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.50
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Alpha Helical Protein, Hydrolase, Family 19 Glycosidase, Regulatory Protein Of The Cell Wall Yield Threshold, Cotyledon (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Morohashi, K. Sasaki, N. Sakabe, K. Sakabe
Three-Dimensional Structure Analysis Of Vigna Unguiculata Chitinase With Regulation Activity Of The Yield Threshold O Cell Wall
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - COTYLEDONEOUS YIELDIN-LIKE PROTEIN
    Chains: A, B
    Fragment: UNP RESIDUES 28-269
    Organ: COTYLEDON
    Organism Common: COWPEA
    Organism Scientific: VIGNA UNGUICULATA
    Organism Taxid: 3917

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3W3E)

(-) Sites  (0, 0)

(no "Site" information available for 3W3E)

(-) SS Bonds  (6, 6)

Asymmetric Unit
No.Residues
1A:24 -A:86
2A:98 -A:104
3A:203 -A:235
4B:24 -B:86
5B:98 -B:104
6B:203 -B:235

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3W3E)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3W3E)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3W3E)

(-) Exons   (0, 0)

(no "Exon" information available for 3W3E)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:242
 aligned with Q8H0C9_VIGUN | Q8H0C9 from UniProtKB/TrEMBL  Length:269

    Alignment length:242
                                    37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267  
         Q8H0C9_VIGUN    28 AEVGSVIGASLFDQLLKHRNDQACEGKGFYSYNAFITAARSFAAFGTTGDSNTRKREVAAFLAQTSHETTGGAATSPDGPYAWGYCFVTERDKSNRYCDGSGPCSAGKSYYGRGPIQLTHNYNYNAAGRALGVDLINNPDLVARDAVVSFKTALWFWMTPQGNKPSCHDVITNRWTPSAADKAANRVPGFGVITNIINGGLECGKGPTPASGDRIGFYKRYCDVFGVSYGPNLNCRDQRPFG 269
               SCOP domains d3w3ea_ A: automated matches                                                                                                                                                                                                                       SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh.hhhhhhhhh..............hhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhh.........hhhhh....................................hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh......hhhhhhh.....hhhhhhh....hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh................ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3w3e A   1 AEVGSVIGASLFDQLLKHRNDQACEGKGFYSYNAFITAARSFAAFGTTGDSNTRKREVAAFLAQTSHETTGGAATSPDGPYAWGYCFVTERDKSNRYCDGSGPCSAGKSYYGRGPIQLTHNYNYNAAGRALGVDLINNPDLVARDAVVSFKTALWFWMTPQGNKPSCHDVITNRWTPSAADKAANRVPGFGVITNIINGGLECGKGPTPASGDRIGFYKRYCDVFGVSYGPNLNCRDQRPFG 242
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240  


Chain B from PDB  Type:PROTEIN  Length:242
 aligned with Q8H0C9_VIGUN | Q8H0C9 from UniProtKB/TrEMBL  Length:269

    Alignment length:242
                                    37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267  
         Q8H0C9_VIGUN    28 AEVGSVIGASLFDQLLKHRNDQACEGKGFYSYNAFITAARSFAAFGTTGDSNTRKREVAAFLAQTSHETTGGAATSPDGPYAWGYCFVTERDKSNRYCDGSGPCSAGKSYYGRGPIQLTHNYNYNAAGRALGVDLINNPDLVARDAVVSFKTALWFWMTPQGNKPSCHDVITNRWTPSAADKAANRVPGFGVITNIINGGLECGKGPTPASGDRIGFYKRYCDVFGVSYGPNLNCRDQRPFG 269
               SCOP domains d3w3eb_ B: automated matches                                                                                                                                                                                                                       SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh.hhhhhhhhh..............hhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhh.........hhhhh....................................hhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh......hhhhhhh.....hhhhhhh....hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh................ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3w3e B   1 AEVGSVIGASLFDQLLKHRNDQACEGKGFYSYNAFITAARSFAAFGTTGDSNTRKREVAAFLAQTSHETTGGAATSPDGPYAWGYCFVTERDKSNRYCDGSGPCSAGKSYYGRGPIQLTHNYNYNAAGRALGVDLINNPDLVARDAVVSFKTALWFWMTPQGNKPSCHDVITNRWTPSAADKAANRVPGFGVITNIINGGLECGKGPTPASGDRIGFYKRYCDVFGVSYGPNLNCRDQRPFG 242
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3W3E)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3W3E)

(-) Gene Ontology  (4, 4)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (Q8H0C9_VIGUN | Q8H0C9)
molecular function
    GO:0004568    chitinase activity    Catalysis of the hydrolysis of (1->4)-beta linkages of N-acetyl-D-glucosamine (GlcNAc) polymers of chitin and chitodextrins.
biological process
    GO:0005975    carbohydrate metabolic process    The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
    GO:0016998    cell wall macromolecule catabolic process    The chemical reactions and pathways resulting in the breakdown of macromolecules that form part of a cell wall.
    GO:0006032    chitin catabolic process    The chemical reactions and pathways resulting in the breakdown of chitin, a linear polysaccharide consisting of beta-(1->4)-linked N-acetyl-D-glucosamine residues.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3w3e)
 
  Sites
(no "Sites" information available for 3w3e)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3w3e)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3w3e
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8H0C9_VIGUN | Q8H0C9
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q8H0C9_VIGUN | Q8H0C9
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3W3E)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3W3E)