Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF XYLOBIOSE-BXLE COMPLEX FROM STREPTOMYCES THERMOVIOLACEUS OPC-520
 
Authors :  K. Tomoo, T. Ishida, K. Miyamoto, H. Tsujibo
Date :  11 Sep 12  (Deposition) - 18 Sep 13  (Release) - 18 Sep 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.85
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  A  (1x)
Biol. Unit 3:  B  (1x)
Keywords :  Abc Transporter, Sugar Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  K. Tomoo, T. Ishida, K. Miyamoto, H. Tsujibo
Crystal Structure Of Xylooligosaccharide-Binding Protein From Streptomyces Thermoviolaceus Opc-520: Dramatic Conformational Change With Ligand Binding
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PUTATIVE SUGAR-BINDING LIPOPROTEIN
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneBXLD
    Organism ScientificSTREPTOMYCES THERMOVIOLACEUS
    Organism Taxid1952

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)AB
Biological Unit 2 (1x)A 
Biological Unit 3 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1BXP2Ligand/Ion4-O-BETA-D-XYLOPYRANOSYL-BETA-D-XYLOPYRANOSE
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
1BXP2Ligand/Ion4-O-BETA-D-XYLOPYRANOSYL-BETA-D-XYLOPYRANOSE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1BXP1Ligand/Ion4-O-BETA-D-XYLOPYRANOSYL-BETA-D-XYLOPYRANOSE
Biological Unit 3 (1, 1)
No.NameCountTypeFull Name
1BXP1Ligand/Ion4-O-BETA-D-XYLOPYRANOSYL-BETA-D-XYLOPYRANOSE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETYR A:44 , ASP A:46 , TRP A:102 , ARG A:153 , GLN A:156 , TRP A:204 , TRP A:286 , ASN A:324 , ASN A:327 , SER A:398 , ASP A:400 , GLN A:401 , HOH A:701 , HOH A:703 , HOH A:714 , HOH A:718BINDING SITE FOR RESIDUE BXP A 601
2AC2SOFTWARETYR B:44 , ASP B:46 , TRP B:102 , ARG B:153 , GLN B:156 , TRP B:204 , TRP B:286 , ASN B:324 , ASN B:327 , SER B:398 , ASP B:400 , GLN B:401 , HOH B:602 , HOH B:620 , HOH B:636 , HOH B:673BINDING SITE FOR RESIDUE BXP B 501

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3VXC)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3VXC)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3VXC)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3VXC)

(-) Exons   (0, 0)

(no "Exon" information available for 3VXC)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:398
 aligned with Q76BU9_STRTL | Q76BU9 from UniProtKB/TrEMBL  Length:436

    Alignment length:398
                                    47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427        
         Q76BU9_STRTL    38 TITAMVYGDDAVKVQDKAASRFNASAEAKKANAKVKMERIPASDYPAKLRTAMGSPNAPDIFFNWGGGSIKAYKEAGQLVDLTDVIKSDEVLSTGFLPSVVAAGSLDGHEYGIPMRGMQPVLLFYNKSVFAEHKLTPPTTWDQLLDNVAKLKKAGVTPFALGGVEIWPELMWLEYLVDRIGGPQVFDKIRNGDASGWGDPAVLKAAQTVKQLVDEGAFGKGFSSVSYNNGGAPALLAKGKAGMHLMGSWEYSTQLGKFPDFAKKDLGWCAFPSFEGGAGDIRNVVGNPCNYWSVNARTGNKDGAIAFLRDCASEAYTKDLIDNGDVPTTTIAENMLDSSPNPEFAKFQYQLVQKAPNFTLSWDQAVDPDWQQPMLTEINKLFVGKSSPEQFVSALKGL 435
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee...hhhhhhhhhhhhhhhhhhhhh...eeeeeehhhhhhhhhhhhhh......eeee..hhhhhhhhhh.....hhhhhhhhhhhhh..hhhhhhh.ee..ee..ee....eeeeeeeehhhhhhh......hhhhhhhhhhhhhhh..eeee.....hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh.....hhhhh....hhhhhhhhh..eeeeeeehhhhhhhhhhhhhhhhhheeee..............eeee...eeee.....hhhhhhhhhhhh.hhhhhhhhhhhh.......hhhhhhhh.hhhhhhhhhhhhhhh..eeehhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3vxc A  38 TITAMVYGDDAVKVQDKAASRFNASAEAKKANAKVKMERIPASDYPAKLRTAMGSPNAPDIFFNWGGGSIKAYKEAGQLVDLTDVIKSDEVLSTGFLPSVVAAGSLDGHEYGIPMRGMQPVLLFYNKSVFAEHKLTPPTTWDQLLDNVAKLKKAGVTPFALGGVEIWPELMWLEYLVDRIGGPQVFDKIRNGDASGWGDPAVLKAAQTVKQLVDEGAFGKGFSSVSYNNGGAPALLAKGKAGMHLMGSWEYSTQLGKFPDFAKKDLGWCAFPSFEGGAGDIRNVVGNPCNYWSVNARTGNKDGAIAFLRDCASEAYTKDLIDNGDVPTTTIAENMLDSSPNPEFAKFQYQLVQKAPNFTLSWDQAVDPDWQQPMLTEINKLFVGKSSPEQFVSALKGL 435
                                    47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427        

Chain B from PDB  Type:PROTEIN  Length:398
 aligned with Q76BU9_STRTL | Q76BU9 from UniProtKB/TrEMBL  Length:436

    Alignment length:398
                                    47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427        
         Q76BU9_STRTL    38 TITAMVYGDDAVKVQDKAASRFNASAEAKKANAKVKMERIPASDYPAKLRTAMGSPNAPDIFFNWGGGSIKAYKEAGQLVDLTDVIKSDEVLSTGFLPSVVAAGSLDGHEYGIPMRGMQPVLLFYNKSVFAEHKLTPPTTWDQLLDNVAKLKKAGVTPFALGGVEIWPELMWLEYLVDRIGGPQVFDKIRNGDASGWGDPAVLKAAQTVKQLVDEGAFGKGFSSVSYNNGGAPALLAKGKAGMHLMGSWEYSTQLGKFPDFAKKDLGWCAFPSFEGGAGDIRNVVGNPCNYWSVNARTGNKDGAIAFLRDCASEAYTKDLIDNGDVPTTTIAENMLDSSPNPEFAKFQYQLVQKAPNFTLSWDQAVDPDWQQPMLTEINKLFVGKSSPEQFVSALKGL 435
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee...hhhhhhhhhhhhhhhhhhhhh...eeeeeehhhhhhhhhhhhhh......eeee..hhhhhhhhhh.....hhhhhhhhhhhhh..hhhhhhh.ee..ee..ee....eeeeeeeehhhhhhh......hhhhhhhhhhhhhhh..eee......hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh.....hhhhh....hhhhhhhhh..eeeeeeehhhhhhhhhhhhhhhhhheeee..............eeee...eeee.....hhhhhhhhhhhh.hhhhhhhhhhhh.......hhhhhhhh.hhhhhhhhhhhhhhh..eeehhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3vxc B  38 TITAMVYGDDAVKVQDKAASRFNASAEAKKANAKVKMERIPASDYPAKLRTAMGSPNAPDIFFNWGGGSIKAYKEAGQLVDLTDVIKSDEVLSTGFLPSVVAAGSLDGHEYGIPMRGMQPVLLFYNKSVFAEHKLTPPTTWDQLLDNVAKLKKAGVTPFALGGVEIWPELMWLEYLVDRIGGPQVFDKIRNGDASGWGDPAVLKAAQTVKQLVDEGAFGKGFSSVSYNNGGAPALLAKGKAGMHLMGSWEYSTQLGKFPDFAKKDLGWCAFPSFEGGAGDIRNVVGNPCNYWSVNARTGNKDGAIAFLRDCASEAYTKDLIDNGDVPTTTIAENMLDSSPNPEFAKFQYQLVQKAPNFTLSWDQAVDPDWQQPMLTEINKLFVGKSSPEQFVSALKGL 435
                                    47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3VXC)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3VXC)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3VXC)

(-) Gene Ontology  (2, 2)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (Q76BU9_STRTL | Q76BU9)
molecular function
    GO:0005215    transporter activity    Enables the directed movement of substances (such as macromolecules, small molecules, ions) into, out of or within a cell, or between cells.
biological process
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BXP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3vxc)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3vxc
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q76BU9_STRTL | Q76BU9
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q76BU9_STRTL | Q76BU9
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q76BU9_STRTL | Q76BU93vxb

(-) Related Entries Specified in the PDB File

3vxb