Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  STRUCTURAL ANALYSIS OF AN EPSILON-CLASS GLUTATHIONE S-TRANSFERASE FROM HOUSEFLY, MUSCA DOMESTICA
 
Authors :  C. Nakamura, M. Sue, T. Miyamoto, S. Yajima
Date :  05 Sep 12  (Deposition) - 27 Feb 13  (Release) - 27 Feb 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,D  (1x)
Biol. Unit 2:  B,C  (1x)
Keywords :  Glutathione Binding, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  C. Nakamura, S. Yajima, T. Miyamoto, M. Sue
Structural Analysis Of An Epsilon-Class Glutathione Transferase From Housefly, Musca Domestica
Biochem. Biophys. Res. Commun. V. 430 1206 2013
PubMed-ID: 23268341  |  Reference-DOI: 10.1016/J.BBRC.2012.12.077

(-) Compounds

Molecule 1 - GLUTATHIONE S-TRANSFERASE 6B
    Chains: A, B, C, D
    EC Number: 2.5.1.18
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21CODONPLUS(DE3)-RIL
    Expression System Taxid: 562
    Expression System Vector Type: PET21A
    Gene: GST-6B
    Mutation: YES
    Organism Common: HOUSE FLY
    Organism Scientific: MUSCA DOMESTICA
    Organism Taxid: 7370

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): A  D
Biological Unit 2 (1x):  BC 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric Unit (1, 4)
No.NameCountTypeFull Name
1GSH4Ligand/IonGLUTATHIONE
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
1GSH2Ligand/IonGLUTATHIONE
Biological Unit 2 (1, 2)
No.NameCountTypeFull Name
1GSH2Ligand/IonGLUTATHIONE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWARESER A:12 , PRO A:14 , LEU A:36 , HIS A:41 , HIS A:53 , THR A:54 , VAL A:55 , PRO A:56 , ASP A:67 , SER A:68 , HIS A:69 , PHE A:108 , ARG A:113 , HOH A:601 , HOH A:755 , HOH A:756 , HOH A:758 , HOH A:761BINDING SITE FOR RESIDUE GSH A 500
2AC2SOFTWARESER B:12 , PRO B:14 , LEU B:36 , HIS B:41 , HIS B:53 , THR B:54 , VAL B:55 , PRO B:56 , ASP B:67 , SER B:68 , HIS B:69 , PHE B:108 , ARG B:113 , HOH B:703 , HOH B:723 , HOH B:828 , HOH B:860 , HOH B:863BINDING SITE FOR RESIDUE GSH B 600
3AC3SOFTWARESER C:12 , PRO C:13 , PRO C:14 , HIS C:41 , HIS C:53 , THR C:54 , VAL C:55 , PRO C:56 , ASP C:67 , SER C:68 , HIS C:69 , PHE C:108 , ARG C:113 , HOH C:802 , HOH C:809 , HOH C:841 , HOH C:901 , HOH C:946 , HOH C:985BINDING SITE FOR RESIDUE GSH C 700
4AC4SOFTWARESER D:12 , PRO D:14 , HIS D:41 , HIS D:53 , THR D:54 , VAL D:55 , PRO D:56 , ASP D:67 , SER D:68 , HIS D:69 , PHE D:108 , ARG D:113 , HOH D:903 , HOH D:929 , HOH D:1027 , HOH D:1065 , HOH D:1068 , HOH D:1089BINDING SITE FOR RESIDUE GSH D 800

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3VWX)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric Unit
No.Residues
1Val A:55 -Pro A:56
2Val B:55 -Pro B:56
3Val C:55 -Pro C:56
4Val D:55 -Pro D:56

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3VWX)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3VWX)

(-) Exons   (0, 0)

(no "Exon" information available for 3VWX)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:218
 aligned with Q9U795_MUSDO | Q9U795 from UniProtKB/TrEMBL  Length:222

    Alignment length:218
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212        
         Q9U795_MUSDO     3 KLVLYGIDPSPPVRACLLTLKALNLPFEYKVVNLFAKEHLSEEYLKKNPQHTVPTLEEDGHLIWDSHPIMAYLVSKYGKDDSLYPKDLLKRAVVDQRMYFEAGVLFQGGLRNITAPLFFRNQTQIPQHQIDSIVESYGFLESFLKNNKYMAGDHLTIADFSIVTSVTSLVAFAEIDQSKFPKLSAWLKSLQSLPFYEEANGAGAKQLVAMVKSKNLTI 220
               SCOP domains d3vwxa1 A:3-87 automated matches                                                     d3vwxa2 A:88-220 automated matches                                                                                                    SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee...hhhhhhhhhhhhhh....eeee.hhhhhhhhhhhhhhhh......eeee..eeeehhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhh.........hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3vwx A   3 KLVLYGIDPSPPVRACLLTLKALNLPFEYKVVNLFAKEHLSEEYLKKNPQHTVPTLEEDGHLIWDSHAIMAYLVSKYGKDDSLYPKDLLKRAVVDQRMYFEAGVLFQGGLRNITAPLFFRNQTQIPQHQIDSIVESYGFLESFLKNNKYMAGDHLTIADFSIVTSVTSLVAFAEIDQSKFPKLSAWLKSLQSLPFYEEANGAGAKQLVAMVKSKNLTI 220
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212        


Chain B from PDB  Type:PROTEIN  Length:218
 aligned with Q9U795_MUSDO | Q9U795 from UniProtKB/TrEMBL  Length:222

    Alignment length:218
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212        
         Q9U795_MUSDO     3 KLVLYGIDPSPPVRACLLTLKALNLPFEYKVVNLFAKEHLSEEYLKKNPQHTVPTLEEDGHLIWDSHPIMAYLVSKYGKDDSLYPKDLLKRAVVDQRMYFEAGVLFQGGLRNITAPLFFRNQTQIPQHQIDSIVESYGFLESFLKNNKYMAGDHLTIADFSIVTSVTSLVAFAEIDQSKFPKLSAWLKSLQSLPFYEEANGAGAKQLVAMVKSKNLTI 220
               SCOP domains d3vwxb1 B:3-87 automated matches                                                     d3vwxb2 B:88-220 automated matches                                                                                                    SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee...hhhhhhhhhhhhhh....eeee.hhhhhhhhhhhhhhhh......eeee..eeeehhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhh.........hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3vwx B   3 KLVLYGIDPSPPVRACLLTLKALNLPFEYKVVNLFAKEHLSEEYLKKNPQHTVPTLEEDGHLIWDSHAIMAYLVSKYGKDDSLYPKDLLKRAVVDQRMYFEAGVLFQGGLRNITAPLFFRNQTQIPQHQIDSIVESYGFLESFLKNNKYMAGDHLTIADFSIVTSVTSLVAFAEIDQSKFPKLSAWLKSLQSLPFYEEANGAGAKQLVAMVKSKNLTI 220
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212        


Chain C from PDB  Type:PROTEIN  Length:220
 aligned with Q9U795_MUSDO | Q9U795 from UniProtKB/TrEMBL  Length:222

    Alignment length:220
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222
         Q9U795_MUSDO     3 KLVLYGIDPSPPVRACLLTLKALNLPFEYKVVNLFAKEHLSEEYLKKNPQHTVPTLEEDGHLIWDSHPIMAYLVSKYGKDDSLYPKDLLKRAVVDQRMYFEAGVLFQGGLRNITAPLFFRNQTQIPQHQIDSIVESYGFLESFLKNNKYMAGDHLTIADFSIVTSVTSLVAFAEIDQSKFPKLSAWLKSLQSLPFYEEANGAGAKQLVAMVKSKNLTIVP 222
               SCOP domains d3vwxc1 C:3-87 automated matches                                                     d3vwxc2 C:88-222 automated matches                                                                                                      SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee...hhhhhhhhhhhhhh....eeee.hhhhhhhhhhhhhhhh......eeee..eeeehhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhh..eeehhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhh.........hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh..eee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3vwx C   3 KLVLYGIDPSPPVRACLLTLKALNLPFEYKVVNLFAKEHLSEEYLKKNPQHTVPTLEEDGHLIWDSHAIMAYLVSKYGKDDSLYPKDLLKRAVVDQRMYFEAGVLFQGGLRNITAPLFFRNQTQIPQHQIDSIVESYGFLESFLKNNKYMAGDHLTIADFSIVTSVTSLVAFAEIDQSKFPKLSAWLKSLQSLPFYEEANGAGAKQLVAMVKSKNLTIVP 222
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222


Chain D from PDB  Type:PROTEIN  Length:220
 aligned with Q9U795_MUSDO | Q9U795 from UniProtKB/TrEMBL  Length:222

    Alignment length:220
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222
         Q9U795_MUSDO     3 KLVLYGIDPSPPVRACLLTLKALNLPFEYKVVNLFAKEHLSEEYLKKNPQHTVPTLEEDGHLIWDSHPIMAYLVSKYGKDDSLYPKDLLKRAVVDQRMYFEAGVLFQGGLRNITAPLFFRNQTQIPQHQIDSIVESYGFLESFLKNNKYMAGDHLTIADFSIVTSVTSLVAFAEIDQSKFPKLSAWLKSLQSLPFYEEANGAGAKQLVAMVKSKNLTIVP 222
               SCOP domains d3vwxd1 D:3-87 automated matches                                                     d3vwxd2 D:88-222 automated matches                                                                                                      SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee...hhhhhhhhhhhhhh....eeee.hhhhhhhhhhhhhhhh......eeee..eeeehhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhh..eeehhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhh.........hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh...eee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3vwx D   3 KLVLYGIDPSPPVRACLLTLKALNLPFEYKVVNLFAKEHLSEEYLKKNPQHTVPTLEEDGHLIWDSHAIMAYLVSKYGKDDSLYPKDLLKRAVVDQRMYFEAGVLFQGGLRNITAPLFFRNQTQIPQHQIDSIVESYGFLESFLKNNKYMAGDHLTIADFSIVTSVTSLVAFAEIDQSKFPKLSAWLKSLQSLPFYEEANGAGAKQLVAMVKSKNLTIVP 222
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 8)

Asymmetric Unit
(-)
Class: All alpha proteins (14657)
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3VWX)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3VWX)

(-) Gene Ontology  (2, 2)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (Q9U795_MUSDO | Q9U795)
molecular function
    GO:0004364    glutathione transferase activity    Catalysis of the reaction: R-X + glutathione = H-X + R-S-glutathione. R may be an aliphatic, aromatic or heterocyclic group; X may be a sulfate, nitrile or halide group.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GSH  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Val A:55 - Pro A:56   [ RasMol ]  
    Val B:55 - Pro B:56   [ RasMol ]  
    Val C:55 - Pro C:56   [ RasMol ]  
    Val D:55 - Pro D:56   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3vwx
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9U795_MUSDO | Q9U795
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.5.1.18
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q9U795_MUSDO | Q9U795
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3VWX)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3VWX)