Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF GLYCOSYLTREHALOSE TREHALOHYDROLASE (E283Q) COMPLEXED WITH MALTOHEPTAOSE
 
Authors :  N. Okazaki, T. Tamada, M. D. Feese, M. Kato, Y. Miura, T. Komeda, K. Kobay K. Kondo, R. Kuroki
Date :  09 Aug 11  (Deposition) - 20 Jun 12  (Release) - 20 Jun 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.66
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  A  (2x)
Keywords :  Alpha/Beta Barrel, Trehalose, Trehalohydrolase, Alpha-Amylase, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  N. Okazaki, T. Tamada, M. D. Feese, M. Kato, Y. Miura, T. Komeda, K. Kobayashi, K. Kondo, M. Blaber, R. Kuroki
Substrate Recognition Mechanism Of A Glycosyltrehalose Trehalohydrolase From Sulfolobus Solfataricus Km1.
Protein Sci. V. 21 539 2012
PubMed-ID: 22334583  |  Reference-DOI: 10.1002/PRO.2039

(-) Compounds

Molecule 1 - MALTO-OLIGOSYLTREHALOSE TREHALOHYDROLASE
    Chains: A
    EC Number: 3.2.1.141
    Engineered: YES
    Expression System: PICHIA JADINII
    Expression System Plasmid: PGUSS2
    Expression System Taxid: 4903
    Expression System Vector Type: PLASMID
    Gene: TREZ
    Mutation: YES
    Organism Scientific: SULFOLOBUS SOLFATARICUS
    Organism Taxid: 2287
    Synonym: MTHASE, 4-ALPHA-D-((1->4)-ALPHA-D-GLUCANO)TREHALOSE TREHALOHYDROLASE, GLYCOSYLTREHALOSE TREHALOHYDROLASE, GTHASE, MALTOOLIGOSYL TREHALOSE TREHALOHYDROLASE

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (1x): A
Biological Unit 2 (2x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 7)

Asymmetric Unit (3, 7)
No.NameCountTypeFull Name
1FLC1Ligand/IonCITRATE ANION
2GLC5Ligand/IonALPHA-D-GLUCOSE
3GOL1Ligand/IonGLYCEROL
Biological Unit 1 (3, 7)
No.NameCountTypeFull Name
1FLC1Ligand/IonCITRATE ANION
2GLC5Ligand/IonALPHA-D-GLUCOSE
3GOL1Ligand/IonGLYCEROL
Biological Unit 2 (3, 14)
No.NameCountTypeFull Name
1FLC2Ligand/IonCITRATE ANION
2GLC10Ligand/IonALPHA-D-GLUCOSE
3GOL2Ligand/IonGLYCEROL

(-) Sites  (7, 7)

Asymmetric Unit (7, 7)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREPRO A:214 , GLY A:216 , GLC A:602BINDING SITE FOR RESIDUE GLC A 601
2AC2SOFTWARETRP A:215 , HIS A:255 , GLN A:283 , ASP A:377 , ASN A:381 , GLC A:604 , HOH A:2125BINDING SITE FOR RESIDUE GLC A 605
3AC3SOFTWARETYR A:152 , HIS A:192 , TRP A:215 , ARG A:250 , ASP A:252 , GLN A:283 , HIS A:376 , ASP A:377 , GLC A:603 , GLC A:605BINDING SITE FOR RESIDUE GLC A 604
4AC4SOFTWARETYR A:152 , ASP A:153 , ASN A:381 , PHE A:427 , ARG A:444 , GLC A:602 , GLC A:604 , HOH A:2025BINDING SITE FOR RESIDUE GLC A 603
5AC5SOFTWAREASP A:153 , PHE A:431 , VAL A:440 , ARG A:444 , GLU A:447 , GLC A:601 , GLC A:603BINDING SITE FOR RESIDUE GLC A 602
6AC6SOFTWAREGLN A:323 , ARG A:382 , GLY A:383 , LYS A:384 , ASN A:448 , HOH A:2059 , HOH A:2060 , HOH A:2091 , HOH A:2109BINDING SITE FOR RESIDUE FLC A 1001
7AC7SOFTWARELYS A:99 , VAL A:292 , ASN A:301 , ILE A:302 , ASP A:303 , ASN A:368 , HOH A:2067 , HOH A:2099BINDING SITE FOR RESIDUE GOL A 1101

(-) SS Bonds  (2, 2)

Asymmetric Unit
No.Residues
1A:298 -A:298
2A:367 -A:491

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3VGG)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3VGG)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3VGG)

(-) Exons   (0, 0)

(no "Exon" information available for 3VGG)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:554
 aligned with TREZ_SULSF | Q55088 from UniProtKB/Swiss-Prot  Length:559

    Alignment length:554
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514       524       534       544       554    
           TREZ_SULSF     5 YKIDGNEVIFTLWAPYQKSVKLKVLEKGLYEMERDEKGYFTITLNNVKVRDRYKYVLDDASEIPDPASRYQPEGVHGPSQIIQESKEFNNETFLKKEDLIIYEIHVGTFTPEGTFEGVIRKLDYLKDLGITAIEIMPIAQFPGKRDWGYDGVYLYAVQNSYGGPEGFRKLVDEAHKKGLGVILDVVYNHVGPEGNYMVKLGPYFSQKYKTPWGLTFNFDDAESDEVRKFILENVEYWIKEYNVDGFRLDAVHAIIDTSPKHILEEIADVVHKYNRIVIAESDLNDPRVVNPKEKCGYNIDAQWVDDFHHSIHAYLTGERQGYYTDFGNLDDIVKSYKDVFVYDGKYSNFRRKTHGEPVGELDGCNFVVYIQNHDQVGNRGKGERIIKLVDRESYKIAAALYLLSPYIPMIFMGEEYGEENPFYFFSDFSDSKLIQGVREGRKKENGQDTDPQDESTFNASKLSWKIDEEIFSFYKILIKMRKELSIACDRRVNVVNGENWLIIKGREYFSLYVFSKSSIEVKYSGTLLLSSNNSFPQHIEEGKYEFDKGFALYK 558
               SCOP domains d3vgga1 A:4-90 Glycosyltrehalose trehalohydrolase, N-terminal domain N                 d3vgga2 A:91-490 Glycosyltrehalose trehalohydrolase, central domain                                                                                                                                                                                                                                                                                                                                             d3vgga3 A:491-557 Glycosyltrehalose trehalohydrolase                SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee....eeeeee.......eeee...eeee.ee....eeeeee.......eeeee.....ee...............ee..............hhhhh.eeee.........hhhhhhhhhhhhhhhh..eeee...ee............eeeee.hhhhhhhhhhhhhhhhhhh..eeeeee..........hhhhh.....................hhhhhhhhhhhhhhhhhhhhh..eeee.hhhhh......hhhhhhhhhhhhh..eeee.....hhhhh.hhhhh.....eeehhhhhhhhhhhhhh..hhhhhhh.hhhhhhhhhhhh.....eee....eee.......hhh.eee...hhhhhhh.....hhhhh.hhhhhhhhhhhhhh...eeeee.hhhhh............hhhhhhhhhhhhhhhh.......hhhhhhh.......hhhhhhhhhhhhhhhhhh........eeeee..eeeee....eeeee...eeeee...eeeeee.......ee..eeeee..eeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3vgg A   4 YKIDGNEVIFTLWAPYQKSVKLKVLEKGLYEMERDEKGYFTITLNNVKVRDRYKYVLDDASEIPDPASRYQPEGVHGPSQIIQESKEFNNETFLKKEDLIIYEIHVGTFTPEGTFEGVIRKLDYLKDLGITAIEIMPIAQFPGKRDWGYDGVYLYAVQNSYGGPEGFRKLVDEAHKKGLGVILDVVYNHVGPEGNYMVKLGPYFSQKYKTPWGLTFNFDDAESDEVRKFILENVEYWIKEYNVDGFRLDAVHAIIDTSPKHILEEIADVVHKYNRIVIAQSDLNDPRVVNPKEKCGYNIDAQWVDDFHHSIHAYLTGERQGYYTDFGNLDDIVKSYKDVFVYDGKYSNFRRKTHGEPVGELDGCNFVVYIQNHDQVGNRGKGERIIKLVDRESYKIAAALYLLSPYIPMIFMGEEYGEENPFYFFSDFSDSKLIQGVREGRKKENGQDTDPQDESTFNASKLSWKIDEEIFSFYKILIKMRKELSIACDRRVNVVNGENWLIIKGREYFSLYVFSKSSIEVKYSGTLLLSSNNSFPQHIEEGKYEFDKGFALYK 557
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543       553
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (3, 3)

Asymmetric Unit
(-)
Class: All beta proteins (24004)
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3VGG)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3VGG)

(-) Gene Ontology  (9, 9)

Asymmetric Unit(hide GO term definitions)
Chain A   (TREZ_SULSF | Q55088)
molecular function
    GO:0033942    4-alpha-D-(1->4)-alpha-D-glucanotrehalose trehalohydrolase activity    Catalysis of the hydrolysis of alpha-(1->4)-D-glucosidic linkage in 4-alpha-D-{(1->4)-alpha-D-glucanosyl}n trehalose to yield trehalose and alpha-(1->4)-D-glucan.
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0016798    hydrolase activity, acting on glycosyl bonds    Catalysis of the hydrolysis of any glycosyl bond.
    GO:0004553    hydrolase activity, hydrolyzing O-glycosyl compounds    Catalysis of the hydrolysis of any O-glycosyl bond.
biological process
    GO:0005975    carbohydrate metabolic process    The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
    GO:0005992    trehalose biosynthetic process    The chemical reactions and pathways resulting in the formation of trehalose, a disaccharide isomeric with sucrose and obtained from certain lichens and fungi.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FLC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GLC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3vgg)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3vgg
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TREZ_SULSF | Q55088
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.2.1.141
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  TREZ_SULSF | Q55088
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TREZ_SULSF | Q55088: 1eh9 1eha 3vgb 3vgd 3vge 3vgf 3vgh

(-) Related Entries Specified in the PDB File

1eh9 3vgc 3vgd 3vge 3vgf 3vgh