Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  B. SUBTILIS SSBB/SSDNA
 
Authors :  T. Yadav, B. Carrasco, A. R. Myers, N. P. George, J. L. Keck, J. C. Alonso
Date :  06 Jan 12  (Deposition) - 14 Mar 12  (Release) - 25 Jul 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.80
Chains :  Asym. Unit :  A,B,C,D,E,F,G
Biol. Unit 1:  A,B,C,D,E,F,G  (2x)
Keywords :  Ob Fold, Single-Strand Dna Binding, Ssdna, Dna Binding Protein-Dna Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  T. Yadav, B. Carrasco, A. R. Myers, N. P. George, J. L. Keck, J. C. Alonso
Genetic Recombination In Bacillus Subtilis: A Division Of Labor Between Two Single-Strand Dna-Binding Proteins.
Nucleic Acids Res. V. 40 5546 2012
PubMed-ID: 22373918  |  Reference-DOI: 10.1093/NAR/GKS173

(-) Compounds

Molecule 1 - SINGLE-STRANDED DNA-BINDING PROTEIN SSBB
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: SSBB, YWPH, BSU36310
    Organism Scientific: BACILLUS SUBTILIS
    Organism Taxid: 1423
    Synonym: SSB
 
Molecule 2 - 5'-D(P*TP*TP*TP*TP*TP*TP*TP*TP*TP*TP*TP*TP*TP*TP*TP*TP*TP*T P*TP*TP*TP*TP*TP*TP*TP*TP*TP*TP*TP*TP*TP*TP*TP*TP*T)-3'
    Chains: C, D, E, F, G
    Engineered: YES
    Organism Scientific: SYNTHETIC DNA
    Organism Taxid: 32630
    Synthetic: YES

 Structural Features

(-) Chains, Units

  1234567
Asymmetric Unit : ABCDEFG
Biological Unit 1 (2x): ABCDEFG

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3VDY)

(-) Sites  (0, 0)

(no "Site" information available for 3VDY)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3VDY)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3VDY)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3VDY)

(-) PROSITE Motifs  (1, 2)

Asymmetric Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SSBPS50935 Single-strand binding (SSB) domain profile.SSBB_BACSU1-104
 		  2A:1-104
B:1-104
Biological Unit 1 (1, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SSBPS50935 Single-strand binding (SSB) domain profile.SSBB_BACSU1-104
 		  4A:1-104
B:1-104

(-) Exons   (0, 0)

(no "Exon" information available for 3VDY)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:101
 aligned with SSBB_BACSU | C0SPB6 from UniProtKB/Swiss-Prot  Length:113

    Alignment length:105
                             1                                                                                                       
                             |       9        19        29        39        49        59        69        79        89        99     
           SSBB_BACSU     - -MFNQVMLVGRLTKDPDLRYTSAGAAVAHVTLAVNRSFKNASGEIEADYVNCTLWRKTAENTALYCQKGSLVGVSGRIQTRSYENEEGVNVYVTEVLADTVRFMD 104
               SCOP domains --------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeee....eeee.....eeeeeeeeee...........eeeeeeeeehhhhhhhhhhh....eeeeeeeeeeeee.----..eeeeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -SSB  PDB: A:1-104 UniProt: 1-104                                                                         PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------- Transcript
                 3vdy A   0 HMFNQVMLVGRLTKDPDLRYTSAGAAVAHVTLAVNRSFKNASGEIEADYVNCTLWRKTAENTALYCQKGSLVGVSGRIQTRSYE----VNVYVTEVLADTVRFMD 104
                                     9        19        29        39        49        59        69        79   |    89        99     
                                                                                                              83   88                


Chain B from PDB  Type:PROTEIN  Length:97
 aligned with SSBB_BACSU | C0SPB6 from UniProtKB/Swiss-Prot  Length:113

    Alignment length:105
                                    10        20        30        40        50        60        70        80        90       100     
           SSBB_BACSU     1 MFNQVMLVGRLTKDPDLRYTSAGAAVAHVTLAVNRSFKNASGEIEADYVNCTLWRKTAENTALYCQKGSLVGVSGRIQTRSYENEEGVNVYVTEVLADTVRFMDP 105
               SCOP domains --------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeee....eeee.....eeeeeeeeee...........eeeeeeeeehhhhhhhhhhh....eeeeeeeeeee--------...eeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE SSB  PDB: B:1-104 UniProt: 1-104                                                                        - PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------- Transcript
                 3vdy B   1 MFNQVMLVGRLTKDPDLRYTSAGAAVAHVTLAVNRSFKNASGEIEADYVNCTLWRKTAENTALYCQKGSLVGVSGRIQTR--------NVYVTEVLADTVRFMDP 105
                                    10        20        30        40        50        60        70        80        90       100     
                                                                                                          80       89                


Chain C from PDB  Type:DNA  Length:4
                                    
                 3vdy C   5 TTTT   8


Chain D from PDB  Type:DNA  Length:3
                                   
                 3vdy D   1 TTT   3


Chain E from PDB  Type:DNA  Length:4
                                    
                 3vdy E  12 TTTT  15


Chain F from PDB  Type:DNA  Length:10
                                          
                 3vdy F   1 TTTTTTTTTT  10
                                    10


Chain G from PDB  Type:DNA  Length:3
                                   
                 3vdy G  14 TTT  16
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3VDY)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3VDY)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3VDY)

(-) Gene Ontology  (6, 6)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (SSBB_BACSU | C0SPB6)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003697    single-stranded DNA binding    Interacting selectively and non-covalently with single-stranded DNA.
biological process
    GO:0006310    DNA recombination    Any process in which a new genotype is formed by reassortment of genes resulting in gene combinations different from those that were present in the parents. In eukaryotes genetic recombination can occur by chromosome assortment, intrachromosomal recombination, or nonreciprocal interchromosomal recombination. Intrachromosomal recombination occurs by crossing over. In bacteria it may occur by genetic transformation, conjugation, transduction, or F-duction.
    GO:0006260    DNA replication    The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
    GO:0030420    establishment of competence for transformation    The process in which a naturally transformable bacterium acquires the ability to take up exogenous DNA. This term should be applied only to naturally transformable bacteria, and should not be used in the context of artificially induced bacterial transformation.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3vdy)
 
  Sites
(no "Sites" information available for 3vdy)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3vdy)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3vdy
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SSBB_BACSU | C0SPB6
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  SSBB_BACSU | C0SPB6
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3VDY)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3VDY)