Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PERAKINE REDUCTASE, FOUNDER MEMBER OF A NOVEL AKR SUBFAMILY WITH UNIQUE CONFORMATIONAL CHANGES DURING NADPH BINDING
 
Authors :  L. Sun, Y. Chen, C. Rajendran, S. Panjikar, U. Mueller, M. Wang, C. Rosen R. Mindnich, T. M. Penning, J. Stoeckigt
Date :  08 Dec 11  (Deposition) - 22 Feb 12  (Release) - 17 Jul 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.77
Chains :  Asym./Biol. Unit :  A
Keywords :  Perakine Reductase, Akr Superfamily, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  L. Sun, Y. Chen, C. Rajendran, U. Mueller, S. Panjikar, M. Wang, R. Mindnich, C. Rosenthal, T. M. Penning, J. Stockigt
Crystal Structure Of Perakine Reductase, Founding Member Of A Novel Aldo-Keto Reductase (Akr) Subfamily That Undergoes Unique Conformational Changes During Nadph Binding.
J. Biol. Chem. V. 287 11213 2012
PubMed-ID: 22334702  |  Reference-DOI: 10.1074/JBC.M111.335521

(-) Compounds

Molecule 1 - PERAKINE REDUCTASE
    Chains: A
    EC Number: 1.1.1.-
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: PR
    Mutation: YES
    Organism Common: DEVILPEPPER
    Organism Scientific: RAUVOLFIA SERPENTINA
    Organism Taxid: 4060

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 7)

Asymmetric/Biological Unit (4, 7)
No.NameCountTypeFull Name
1ATR1Ligand/Ion2'-MONOPHOSPHOADENOSINE-5'-DIPHOSPHATE
2M3L2Mod. Amino AcidN-TRIMETHYLLYSINE
3MLY1Mod. Amino AcidN-DIMETHYL-LYSINE
4MLZ3Mod. Amino AcidN-METHYL-LYSINE

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWARESER A:205 , PRO A:206 , ILE A:207 , GLY A:208 , LEU A:211 , PRO A:278 , GLY A:279 , THR A:280 , THR A:281 , ASN A:285 , ASN A:288 , ASN A:289 , HOH A:542 , HOH A:549 , HOH A:600 , HOH A:650 , HOH A:660BINDING SITE FOR RESIDUE ATR A 401

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3V0S)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3V0S)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3V0S)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3V0S)

(-) Exons   (0, 0)

(no "Exon" information available for 3V0S)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:287
 aligned with PERR_RAUSE | Q3L181 from UniProtKB/Swiss-Prot  Length:337

    Alignment length:336
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330      
           PERR_RAUSE     1 MPRVKLGTQGLEVSKLGFGCMGLSGDYNDALPEEQGIAVIKEAFNCGITFFDTSDIYGENGSNEELLGKALKQLPREKIQVGTKFGIHEIGFSGVKAKGTPDYVRSCCEASLKRLDVDYIDLFYIHRIDTTVPIEITMGELKKLVEEGKIKYVGLSEASPDTIRRAHAVHPVTALQIEYSLWTRDIEDEIVPLCRQLGIGIVPYSPIGRGLFAGKAIKESLPENSVLTSHPRFVGENLEKNKQIYYRIEALSQKHGCTPVQLALAWVLHQGEDVVPIPGTTKIKNLHNNVGALKVKLTKEDLKEISDAVPLDEVAGESIHEVIAVTNWKFANTPPL 336
               SCOP domains d3v0sa1 A:1-305 automate       d matches                                                                                                                                                                                                                                                                         -----                 --------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eee......eee...ee.hhhh-------.hhhhhhhhhhhhhh...eee........hhhhhhhhhhhhhhhhhhheeeeee.eeeee..eeee..hhhhhhhhhhhhhhhhh...eeeeee.......hhhhhhhhhhhhhhh..eeeeeee..hhhhhhhhhhhh...eeeee.....hhhhhhhhhhhhhhh.eeeee..hhhhhhhhhhhhh-------------------------.hhhhhhhhhh..hhhhhhhhhhhh............hhhhhhhhhhhhhh..hhhhhhhhhhh..-----------------......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3v0s A   1 MPRVKLGTQGLEVSKLGFGCMGLS-------PEEQGIAVIKEAFNCGITFFDTSDIYGENGSNEELLGKALKQLPREkIQVGTKFGIHEIGFSGVKAkGTPDYVRSCCEASLKRLDVDYIDLFYIHRIDTTVPIEITMGELkkLVEEGKIkYVGLSEASPDTIRRAHAVHPVTALQIEYSLWTRDIEDEIVPLCRQLGIGIVPYSPIGRGLFWGKAIKE-------------------------YYRIEALSQKHGCTPVQLALAWVLHQGEDVVPIPGTTKIKNLHNNVGALKVkLTKEDLKEISDAVP-----------------WKFANTPPL 336
                                    10        20   |     - |      40        50        60        70       |80        90       100       110       120       130       140 ||    150|      160       170       180       190       200       210        |-         -         -    |  250       260       270       280       290     | 300       310         -       330      
                                                  24      32                                            78-MLZ              98-M3L                                     142-MLY  151-MLZ                                                             219                       245                                                296-M3L       310               328        
                                                                                                                                                                        143-MLZ
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3V0S)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3V0S)

(-) Gene Ontology  (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (PERR_RAUSE | Q3L181)
molecular function
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
    GO:0009820    alkaloid metabolic process    The chemical reactions and pathways involving alkaloids, nitrogen containing natural products which are not otherwise classified as peptides, nonprotein amino acids, amines, cyanogenic glycosides, glucosinolates, cofactors, phytohormones or primary metabolites (such as purine or pyrimidine bases).
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ATR  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    M3L  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MLY  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MLZ  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3v0s)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3v0s
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PERR_RAUSE | Q3L181
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.1.1.-
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  PERR_RAUSE | Q3L181
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PERR_RAUSE | Q3L181: 3uyi 3v0t 3v0u

(-) Related Entries Specified in the PDB File

3v0t 3v0u