|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 3US6) |
Sites (0, 0)| (no "Site" information available for 3US6) |
SS Bonds (0, 0)| (no "SS Bond" information available for 3US6) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3US6) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3US6) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3US6) |
Exons (0, 0)| (no "Exon" information available for 3US6) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:148 aligned with B7FGU6_MEDTR | B7FGU6 from UniProtKB/TrEMBL Length:153 Alignment length:148 11 21 31 41 51 61 71 81 91 101 111 121 131 141 B7FGU6_MEDTR 2 EVGQMRRQWVDYIKSMFMEGFLDGQFLQLQQLQDENNPEFVFEVVSLFFDDSERILKDLSFAVDQQSIDFKKVDAHVHQFKGSSASIGAQRVKNSCVAFRNFCEEQNIDACRRCLQQVKQEYLLVKNKLETLLRLEQQIVAAGGSIPM 149 SCOP domains d3us6a_ A: automated matches SCOP domains CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 3us6 A 2 EVGQMRRQWVDYIKSMFMEGFLDGQFLQLQQLQDENNPEFVFEVVSLFFDDSERILKDLSFAVDQQSIDFKKVDAHVHQFKGSSASIGAQRVKNSCVAFRNFCEEQNIDACRRCLQQVKQEYLLVKNKLETLLRLEQQIVAAGGSIPM 149 11 21 31 41 51 61 71 81 91 101 111 121 131 141
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3US6) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3US6) |
Gene Ontology (8, 8)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (B7FGU6_MEDTR | B7FGU6)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|