Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF A PUTATIVE NAD(P) DEPENDENT GLUCONATE 5-DEHYDROGENASE FROM BEUTENBERGIA CAVERNAE(EFI TARGET EFI-502044) WITH BOUND NADP (LOW OCCUPANCY)
 
Authors :  M. W. Vetting, R. Toro, R. Bhosle, B. Hillerich, E. Washington, A. Scott S. Chowdhury, B. Evans, J. Hammonds, W. D. Zencheck, H. J. Imker, J. A. G S. C. Almo, Enzyme Function Initiative (Efi)
Date :  31 Oct 11  (Deposition) - 23 Nov 11  (Release) - 22 Feb 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (2x)
Biol. Unit 2:  A,B  (1x)
Biol. Unit 3:  A,B  (2x)
Keywords :  Gluconate, Gluconate 5-Dehydratase, Nad(P) Dependent, Enzyme Function Initiative, Efi, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. W. Vetting, R. Toro, R. Bhosle, B. Hillerich, E. Washington, A. Scott Glenn, S. Chowdhury, B. Evans, J. Hammonds, W. D. Zencheck, H. J. Imker, J. A. Gerlt, S. C. Almo, Enzyme Function Initiative (Efi)
Crystal Structure Of A Putative Nad(P) Dependent Gluconate 5-Dehydrogenase From Beutenbergia Cavernae(Efi Target Efi-502044) With Bound Nadp (Low Occupancy)
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - SHORT-CHAIN DEHYDROGENASE/REDUCTASE SDR
    ChainsA, B
    EC Number1.1.1.125
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET
    Expression System StrainBL21(DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneBCAV_0642
    Organism ScientificBEUTENBERGIA CAVERNAE
    Organism Taxid471853
    StrainDSM 12333

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (2x)AB
Biological Unit 2 (1x)AB
Biological Unit 3 (2x)AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1NAP2Ligand/IonNADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
Biological Unit 1 (1, 4)
No.NameCountTypeFull Name
1NAP4Ligand/IonNADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
Biological Unit 2 (1, 2)
No.NameCountTypeFull Name
1NAP2Ligand/IonNADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
Biological Unit 3 (1, 4)
No.NameCountTypeFull Name
1NAP4Ligand/IonNADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY A:16 , SER A:19 , GLY A:20 , ILE A:21 , ARG A:41 , THR A:42 , ASP A:65 , LEU A:66 , ALA A:67 , ASN A:91 , ALA A:92 , GLY A:93 , ILE A:94 , ILE A:141 , ALA A:142 , SER A:143 , TYR A:156 , LYS A:160 , PRO A:186 , GLY A:187 , TYR A:188 , VAL A:189 , THR A:191 , ASN A:193 , THR A:194 , HOH A:292 , HOH A:319 , HOH A:321 , HOH A:366 , HOH A:367BINDING SITE FOR RESIDUE NAP A 274
2AC2SOFTWAREGLY B:16 , SER B:19 , GLY B:20 , ILE B:21 , ARG B:41 , ASP B:65 , LEU B:66 , ALA B:67 , ASN B:91 , ALA B:92 , GLY B:93 , ILE B:94 , ILE B:141 , ALA B:142 , SER B:143 , TYR B:156 , LYS B:160 , PRO B:186 , GLY B:187 , VAL B:189 , THR B:191 , ALA B:192 , ASN B:193 , THR B:194 , HOH B:285 , HOH B:331 , HOH B:359BINDING SITE FOR RESIDUE NAP B 274

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3UF0)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3UF0)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3UF0)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3UF0)

(-) Exons   (0, 0)

(no "Exon" information available for 3UF0)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:249
 aligned with C5BY10_BEUC1 | C5BY10 from UniProtKB/TrEMBL  Length:251

    Alignment length:249
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242         
         C5BY10_BEUC1     3 GPFSLAGRTAVVTGAGSGIGRAIAHGYARAGAHVLAWGRTDGVKEVADEIADGGGSAEAVVADLADLEGAANVAEELAATRRVDVLVNNAGIIARAPAEEVSLGRWREVLTVNLDAAWVLSRSFGTAMLAHGSGRIVTIASMLSFQGGRNVAAYAASKHAVVGLTRALASEWAGRGVGVNALAPGYVVTANTAALRADDERAAEITARIPAGRWATPEDMVGPAVFLASDAASYVHGQVLAVDGGWLAS 251
               SCOP domains d3uf0a_ A: automated matches                                                                                                                                                                                                                              SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeeee...hhhhhhhhhhhhhh..eeeeee..hhhhhhhhhhhh...eeeeee....hhhhhhhhhhhhhhhh...eeee........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeee.hhhhh.....hhhhhhhhhhhhhhhhhhhhhhh...eeeeeeee....hhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.....eeee..hhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3uf0 A   3 GPFSLAGRTAVVTGAGSGIGRAIAHGYARAGAHVLAWGRTDGVKEVADEIADGGGSAEAVVADLADLEGAANVAEELAATRRVDVLVNNAGIIARAPAEEVSLGRWREVLTVNLDAAWVLSRSFGTAMLAHGSGRIVTIASMLSFQGGRNVAAYAASKHAVVGLTRALASEWAGRGVGVNALAPGYVVTANTAALRADDERAAEITARIPAGRWATPEDMVGPAVFLASDAASYVHGQVLAVDGGWLAS 251
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242         

Chain B from PDB  Type:PROTEIN  Length:249
 aligned with C5BY10_BEUC1 | C5BY10 from UniProtKB/TrEMBL  Length:251

    Alignment length:249
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242         
         C5BY10_BEUC1     3 GPFSLAGRTAVVTGAGSGIGRAIAHGYARAGAHVLAWGRTDGVKEVADEIADGGGSAEAVVADLADLEGAANVAEELAATRRVDVLVNNAGIIARAPAEEVSLGRWREVLTVNLDAAWVLSRSFGTAMLAHGSGRIVTIASMLSFQGGRNVAAYAASKHAVVGLTRALASEWAGRGVGVNALAPGYVVTANTAALRADDERAAEITARIPAGRWATPEDMVGPAVFLASDAASYVHGQVLAVDGGWLAS 251
               SCOP domains d3uf0b_ B: automated matches                                                                                                                                                                                                                              SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeeee...hhhhhhhhhhhhhh..eeeeee..hhhhhhhhhhhhh..eeeeee....hhhhhhhhhhhhhhhh...eeee........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeee.hhhhh.....hhhhhhhhhhhhhhhhhhhhhhh...eeeeeeee....hhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.....eeee..hhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3uf0 B   3 GPFSLAGRTAVVTGAGSGIGRAIAHGYARAGAHVLAWGRTDGVKEVADEIADGGGSAEAVVADLADLEGAANVAEELAATRRVDVLVNNAGIIARAPAEEVSLGRWREVLTVNLDAAWVLSRSFGTAMLAHGSGRIVTIASMLSFQGGRNVAAYAASKHAVVGLTRALASEWAGRGVGVNALAPGYVVTANTAALRADDERAAEITARIPAGRWATPEDMVGPAVFLASDAASYVHGQVLAVDGGWLAS 251
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3UF0)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3UF0)

(-) Gene Ontology  (4, 4)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (C5BY10_BEUC1 | C5BY10)
molecular function
    GO:0008678    2-deoxy-D-gluconate 3-dehydrogenase activity    Catalysis of the reaction: 2-deoxy-D-gluconate + NAD+ = 3-dehydro-2-deoxy-D-gluconate + NADH + H+.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    NAP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3uf0)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3uf0
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  C5BY10_BEUC1 | C5BY10
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  1.1.1.125
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  C5BY10_BEUC1 | C5BY10
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3UF0)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3UF0)