3UE8 - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Title :   KYNURENINE AMINOTRANSFERASE II INHIBITORS

Authors :   A. B. Dounay, M. Anderson, B. M. Bechle, B. M. Campbell, M. M. Claffey, A. Evdokimov, E. Edelweiss, K. R. Fonseca, X. Gan, S. Ghosh, M. M. Haywa W. Horner, J. Y. Kim, L. A. Mcallister, J. Pandit, V. Paradis, V. D. Pari M. R. Reese, S. B. Rong, M. A. Salafia, K. Schuyten, C. A. Strick, J. B. Tu J. Valentine, H. Wang, L. E. Zawadzke, P. R. Verhoest

Date :   28 Oct 11 (Deposition) - 01 Feb 12 (Release) - 01 Feb 12 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.22

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: A,B  (1x)

Keywords :   Kat Ii, Kynurenine Aminotransferase, Transferase-Transferase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   A. B. Dounay, M. Anderson, B. M. Bechle, B. M. Campbell, M. M. Claffey, A. Evdokimov, E. Edelweiss, K. R. Fonseca, X. Gan, S. Ghosh, M. M. Hayward, W. Horner, J. Y. Kim, L. A. Mcallister, J. Pandit, V. Paradis, V. D. Parikh, M. R. Reese, S. B. Rong, M. A. Salafia, K. Schuyten, C. A. Strick, J. B. Tuttle, J. Valentine, H. Wang, L. E. Zawadzke, P. R. Verhoest
Discovery Of Brain-Penetrant, Irreversible Kynurenine Aminotransferase Ii Inhibitors For Schizophrenia
Acs Med. Chem. Lett. 2012
PubMed: search | Reference-DOI: 10.1021/ML200204M

Molecule 1 - KYNURENINE/ALPHA-AMINOADIPATE AMINOTRANSFERASE, MITOCHONDRIAL
	Chains	:	A, B
	EC Number	:	2.6.1.39, 2.6.1.7
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Gene	:	AADAT, KAT2
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	2-AMINOADIPATE AMINOTRANSFERASE, 2-AMINOADIPATE TRANSAMINASE, ALPHA-AMINOADIPATE AMINOTRANSFERASE, AADAT, KAT/AADAT, KYNURENINE AMINOTRANSFERASE II, KYNURENINE--OXOGLUTARATE AMINOTRANSFERASE II, KYNURENINE--OXOGLUTARATE TRANSAMINASE II

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B
Biological Unit 3 (1x)	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 4)

No.	Name	Count	Type	Full Name
1	09M	2	Ligand/Ion	(5-HYDROXY-4-{[(1-HYDROXY-2-OXO-1,2-DIHYDROQUINOLIN-3-YL)AMINO]METHYL}-6-METHYLPYRIDIN-3-YL)METHYLDIHYDROGEN PHOSPHATE
2	CL	2	Ligand/Ion	CHLORIDE ION

Biological Unit 1 (1, 1)

No.	Name	Count	Type	Full Name
1	09M	1	Ligand/Ion	(5-HYDROXY-4-{[(1-HYDROXY-2-OXO-1,2-DIHYDROQUINOLIN-3-YL)AMINO]METHYL}-6-METHYLPYRIDIN-3-YL)METHYLDIHYDROGEN PHOSPHATE
2	CL	-1	Ligand/Ion	CHLORIDE ION

Biological Unit 2 (1, 1)

No.	Name	Count	Type	Full Name
1	09M	1	Ligand/Ion	(5-HYDROXY-4-{[(1-HYDROXY-2-OXO-1,2-DIHYDROQUINOLIN-3-YL)AMINO]METHYL}-6-METHYLPYRIDIN-3-YL)METHYLDIHYDROGEN PHOSPHATE
2	CL	-1	Ligand/Ion	CHLORIDE ION

Biological Unit 3 (1, 2)

No.	Name	Count	Type	Full Name
1	09M	2	Ligand/Ion	(5-HYDROXY-4-{[(1-HYDROXY-2-OXO-1,2-DIHYDROQUINOLIN-3-YL)AMINO]METHYL}-6-METHYLPYRIDIN-3-YL)METHYLDIHYDROGEN PHOSPHATE
2	CL	-1	Ligand/Ion	CHLORIDE ION

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLY A:116 , SER A:117 , GLN A:118 , TYR A:142 , ASN A:202 , ASP A:230 , PRO A:232 , TYR A:233 , SER A:260 , SER A:262 , LYS A:263 , ARG A:270 , PHE A:355 , ARG A:399 , TYR B:74	BINDING SITE FOR RESIDUE 09M A 440
2	AC2	SOFTWARE	GLY A:39 , TYR A:74 , GLY B:116 , SER B:117 , GLN B:118 , TYR B:142 , ASN B:202 , ASP B:230 , PRO B:232 , TYR B:233 , SER B:260 , SER B:262 , LYS B:263 , ARG B:270 , ARG B:399	BINDING SITE FOR RESIDUE 09M B 440
3	AC3	SOFTWARE	TRP A:178 , ASN A:189	BINDING SITE FOR RESIDUE CL A 441
4	AC4	SOFTWARE	TRP B:178 , ASN B:189	BINDING SITE FOR RESIDUE CL B 441

(no "SS Bond" information available for 3UE8)

Asymmetric Unit

No.	Residues
1	Glu A:139	-	Pro A:140
2	Asn A:202	-	Pro A:203
3	Glu B:139	-	Pro B:140
4	Asn B:202	-	Pro B:203

Asymmetric Unit (1, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_061005	V	243	I	AADAT_HUMAN	Polymorphism	56350236	A/B	V	243	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_061005	V	243	I	AADAT_HUMAN	Polymorphism	56350236	A	V	243	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_061005	V	243	I	AADAT_HUMAN	Polymorphism	56350236	B	V	243	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (1, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_061005	V	243	I	AADAT_HUMAN	Polymorphism	56350236	A/B	V	243	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 3UE8)

Asymmetric Unit (13, 26)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.3c	ENST00000353187	3c	ENSE00001220119	chr4:171011372-171011295	78	AADAT_HUMAN	-	0	0	-	-
1.4b	ENST00000353187	4b	ENSE00001139506	chr4:171010887-171010775	113	AADAT_HUMAN	1-23	23	2	A:1-16 B:1-17	16 17
1.6a	ENST00000353187	6a	ENSE00000970552	chr4:171009715-171009547	169	AADAT_HUMAN	23-79	57	2	A:34-79 B:29-79	46 51
1.7	ENST00000353187	7	ENSE00000741009	chr4:171008399-171008267	133	AADAT_HUMAN	79-123	45	2	A:79-123 B:79-123	45 45
1.8	ENST00000353187	8	ENSE00000970553	chr4:170999734-170999660	75	AADAT_HUMAN	124-148	25	2	A:124-148 B:124-148	25 25
1.9c	ENST00000353187	9c	ENSE00000970554	chr4:170994496-170994287	210	AADAT_HUMAN	149-218	70	2	A:149-218 B:149-218	70 70
1.10b	ENST00000353187	10b	ENSE00000970555	chr4:170991803-170991738	66	AADAT_HUMAN	219-240	22	2	A:219-240 B:219-240	22 22
1.11	ENST00000353187	11	ENSE00000970556	chr4:170990381-170990299	83	AADAT_HUMAN	241-268	28	2	A:241-268 B:241-268	28 28
1.12	ENST00000353187	12	ENSE00000970557	chr4:170989838-170989742	97	AADAT_HUMAN	268-300	33	2	A:268-300 B:268-300	33 33
1.13	ENST00000353187	13	ENSE00000970558	chr4:170988539-170988478	62	AADAT_HUMAN	301-321	21	2	A:301-321 B:301-321	21 21
1.14	ENST00000353187	14	ENSE00000970559	chr4:170987629-170987565	65	AADAT_HUMAN	321-343	23	2	A:321-343 B:321-343	23 23
1.15	ENST00000353187	15	ENSE00001151624	chr4:170985976-170985870	107	AADAT_HUMAN	343-378	36	2	A:343-378 B:343-378	36 36
1.16	ENST00000353187	16	ENSE00001151616	chr4:170983144-170983043	102	AADAT_HUMAN	379-412	34	2	A:379-412 B:379-412	34 34
1.17a	ENST00000353187	17a	ENSE00002069309	chr4:170982120-170981380	741	AADAT_HUMAN	413-425	13	2	A:413-425 B:413-425	13 13

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:410
 aligned with AADAT_HUMAN | Q8N5Z0 from UniProtKB/Swiss-Prot  Length:425

    Alignment length:427
                                                                                                                                                                                                                                                                                                                                                                                                                                                                  425  
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420    |  
          AADAT_HUMAN     1 MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL--   -
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhh...-----------------........hhhhh.eeeeeeee....eeeehhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeee.hhhhhhhhhhhhhh....eeee....hhhhhhhhh....eeee........hhhhhhhhhhhhhhhhhh........eeee............hhhhhhhhhhhhhhh..eeeee........................eeeeee...........eeeeeehhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eee.......eeeeee......hhhhhh.hhhh.ee.ee.hhhh........eeeee....hhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------I---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.4b  PDB: A:1-16 -------------------------------------------------------Exon 1.7  PDB: A:79-123 UniProt: 79-123      Exon 1.8  PDB: A:124-148 Exon 1.9c  PDB: A:149-218 UniProt: 149-218                            Exon 1.10b            Exon 1.11  PDB: A:241-268   --------------------------------Exon 1.13            ---------------------Exon 1.15  PDB: A:343-378           Exon 1.16  PDB: A:379-412         Exon 1.17a   -- Transcript 1 (1)
           Transcript 1 (2) ----------------------Exon 1.6a  PDB: A:34-79 UniProt: 23-79 [INCOMPLETE]      --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.12  PDB: A:268-300        --------------------Exon 1.14              ------------------------------------------------------------------------------------ Transcript 1 (2)
                 3ue8 A   1 MNYARFITAASAARNP-----------------ISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESLLV 427
                                    10     |   -         -   |    40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       
                                          16                34

Chain B from PDB  Type:PROTEIN  Length:414
 aligned with AADAT_HUMAN | Q8N5Z0 from UniProtKB/Swiss-Prot  Length:425

    Alignment length:425
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420     
          AADAT_HUMAN     1 MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL 425
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh...-----------.....ee......hhhhh.eeeeeeee..eeeeeehhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhh......eeeeeehhhhhhhhhhhhhhh....eeee....hhhhhhhhh....eeee..ee..eehhhhhhhhhh................eeee............hhhhhhhhhhhhhhh..eeeee..............hhhhhh....eeeeee...........eeeeeehhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eee.......eeeeee.....hhhhhhh.hhhhh....hhhhhh........eeeee....hhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------I-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.4b  PDB: B:1-17 -------------------------------------------------------Exon 1.7  PDB: B:79-123 UniProt: 79-123      Exon 1.8  PDB: B:124-148 Exon 1.9c  PDB: B:149-218 UniProt: 149-218                            Exon 1.10b            Exon 1.11  PDB: B:241-268   --------------------------------Exon 1.13            ---------------------Exon 1.15  PDB: B:343-378           Exon 1.16  PDB: B:379-412         Exon 1.17a    Transcript 1 (1)
           Transcript 1 (2) ----------------------Exon 1.6a  PDB: B:29-79 UniProt: 23-79 [INCOMPLETE]      --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.12  PDB: B:268-300        --------------------Exon 1.14              ---------------------------------------------------------------------------------- Transcript 1 (2)
                 3ue8 B   1 MNYARFITAASAARNPS-----------GPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL 425
                                    10      |  -        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420     
                                           17          29

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 3UE8)

(no "CATH Domain" information available for 3UE8)

(no "Pfam Domain" information available for 3UE8)

Asymmetric Unit(hide GO term definitions)

Chain A,B (AADAT_HUMAN | Q8N5Z0)

molecular function
	GO:0047536	2-aminoadipate transaminase activity	Catalysis of the reaction: 2-oxoglutarate + L-2-aminoadipate = 2-oxoadipate + L-glutamate.
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0016212	kynurenine-oxoglutarate transaminase activity	Catalysis of the reaction: L-kynurenine + 2-oxoglutarate = 4-(2-aminophenyl)-2,4-dioxobutanoate + L-glutamate.
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0030170	pyridoxal phosphate binding	Interacting selectively and non-covalently with pyridoxal 5' phosphate, 3-hydroxy-5-(hydroxymethyl)-2-methyl4-pyridine carboxaldehyde 5' phosphate, the biologically active form of vitamin B6.
	GO:0008483	transaminase activity	Catalysis of the transfer of an amino group to an acceptor, usually a 2-oxo acid.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0006103	2-oxoglutarate metabolic process	The chemical reactions and pathways involving oxoglutarate, the dianion of 2-oxoglutaric acid. It is a key constituent of the TCA cycle and a key intermediate in amino-acid metabolism.
	GO:0097052	L-kynurenine metabolic process	The chemical reactions and pathways involving L-kynurenine, the L-enantiomer of the amino acid kynurenine (3-(2-aminobenzoyl)-alanine).
	GO:0033512	L-lysine catabolic process to acetyl-CoA via saccharopine	The chemical reactions and pathways resulting in the breakdown of L-lysine into other compounds, including acetyl-CoA, via the intermediate saccharopine.
	GO:0009058	biosynthetic process	The chemical reactions and pathways resulting in the formation of substances; typically the energy-requiring part of metabolism in which simpler substances are transformed into more complex ones.
	GO:0006536	glutamate metabolic process	The chemical reactions and pathways involving glutamate, the anion of 2-aminopentanedioic acid.
	GO:0070189	kynurenine metabolic process	The chemical reactions and pathways involving kynurenine, the amino acid 3-(2-aminobenzoyl)-alanine.
	GO:0006554	lysine catabolic process	The chemical reactions and pathways resulting in the breakdown of lysine, 2,6-diaminohexanoic acid.
	GO:0006569	tryptophan catabolic process	The chemical reactions and pathways resulting in the breakdown of tryptophan, the chiral amino acid 2-amino-3-(1H-indol-3-yl)propanoic acid.
	GO:0019441	tryptophan catabolic process to kynurenine	The chemical reactions and pathways resulting in the breakdown of tryptophan into other compounds, including kynurenine.
cellular component
	GO:0005759	mitochondrial matrix	The gel-like material, with considerable fine structure, that lies in the matrix space, or lumen, of a mitochondrion. It contains the enzymes of the tricarboxylic acid cycle and, in some organisms, the enzymes concerned with fatty acid oxidation.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		09M	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		CL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Asn A:202 - Pro A:203	[ RasMol ]
		Asn B:202 - Pro B:203	[ RasMol ]
		Glu A:139 - Pro A:140	[ RasMol ]
		Glu B:139 - Pro B:140	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3ue8
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	AADAT_HUMAN \| Q8N5Z0
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.6.1.39
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc
	2.6.1.7
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	AADAT_HUMAN \| Q8N5Z0
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	AADAT_HUMAN \| Q8N5Z0	:	2qlr 2r2n 2vgz 2xh1 3dc1 4gdy 4ge4 4ge7 4ge9 4geb 5efs 5eun 5tf5

(no "Related Entries Specified in the PDB File" available for 3UE8)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 4)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 2)

PROSITE Motifs (0, 0)

Exons (13, 26)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (18, 18)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File