3U8Z - JenaLib

Asymmetric Unit (13, 51)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_000809	L	46	R	MERL_HUMAN	Unclassified	---	A/B/C/D	L	46	R
02	UniProt	VAR_000810	F	62	S	MERL_HUMAN	Disease (NF2)	121434261	A/B/C/D	F	62	S
03	UniProt	VAR_043011	M	77	V	MERL_HUMAN	Disease (NF2)	---	A/B/C/D	M	77	V
04	UniProt	VAR_000811	K	79	E	MERL_HUMAN	Unclassified	---	A/B/C/D	K	79	E
05	UniProt	VAR_000813	E	106	G	MERL_HUMAN	Disease (NF2)	---	A/B/C/D	E	106	G
06	UniProt	VAR_000814	L	117	I	MERL_HUMAN	Unclassified	---	A/B/C/D	L	117	I
07	UniProt	VAR_065227	C	133	R	MERL_HUMAN	Disease (NF2)	---	A/B/C/D	C	133	R
08	UniProt	VAR_043012	L	141	P	MERL_HUMAN	Disease (NF2)	---	A/B/C/D	L	141	P
09	UniProt	VAR_043013	G	197	C	MERL_HUMAN	Disease (NF2)	---	A/B/C	G	197	C
10	UniProt	VAR_000817	V	219	M	MERL_HUMAN	Unclassified	---	A/B/C/D	V	219	M
11	UniProt	VAR_000818	N	220	Y	MERL_HUMAN	Disease (NF2)	---	A/B/C/D	N	220	Y
12	UniProt	VAR_009123	L	234	R	MERL_HUMAN	Disease (NF2)	---	A/B/C/D	L	234	R
13	UniProt	VAR_000819	I	273	F	MERL_HUMAN	Unclassified	---	A/B/C/D	I	273	F

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (13, 26)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_000809	L	46	R	MERL_HUMAN	Unclassified	---	A/C	L	46	R
02	UniProt	VAR_000810	F	62	S	MERL_HUMAN	Disease (NF2)	121434261	A/C	F	62	S
03	UniProt	VAR_043011	M	77	V	MERL_HUMAN	Disease (NF2)	---	A/C	M	77	V
04	UniProt	VAR_000811	K	79	E	MERL_HUMAN	Unclassified	---	A/C	K	79	E
05	UniProt	VAR_000813	E	106	G	MERL_HUMAN	Disease (NF2)	---	A/C	E	106	G
06	UniProt	VAR_000814	L	117	I	MERL_HUMAN	Unclassified	---	A/C	L	117	I
07	UniProt	VAR_065227	C	133	R	MERL_HUMAN	Disease (NF2)	---	A/C	C	133	R
08	UniProt	VAR_043012	L	141	P	MERL_HUMAN	Disease (NF2)	---	A/C	L	141	P
09	UniProt	VAR_043013	G	197	C	MERL_HUMAN	Disease (NF2)	---	A/C	G	197	C
10	UniProt	VAR_000817	V	219	M	MERL_HUMAN	Unclassified	---	A/C	V	219	M
11	UniProt	VAR_000818	N	220	Y	MERL_HUMAN	Disease (NF2)	---	A/C	N	220	Y
12	UniProt	VAR_009123	L	234	R	MERL_HUMAN	Disease (NF2)	---	A/C	L	234	R
13	UniProt	VAR_000819	I	273	F	MERL_HUMAN	Unclassified	---	A/C	I	273	F

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (13, 25)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_000809	L	46	R	MERL_HUMAN	Unclassified	---	B/D	L	46	R
02	UniProt	VAR_000810	F	62	S	MERL_HUMAN	Disease (NF2)	121434261	B/D	F	62	S
03	UniProt	VAR_043011	M	77	V	MERL_HUMAN	Disease (NF2)	---	B/D	M	77	V
04	UniProt	VAR_000811	K	79	E	MERL_HUMAN	Unclassified	---	B/D	K	79	E
05	UniProt	VAR_000813	E	106	G	MERL_HUMAN	Disease (NF2)	---	B/D	E	106	G
06	UniProt	VAR_000814	L	117	I	MERL_HUMAN	Unclassified	---	B/D	L	117	I
07	UniProt	VAR_065227	C	133	R	MERL_HUMAN	Disease (NF2)	---	B/D	C	133	R
08	UniProt	VAR_043012	L	141	P	MERL_HUMAN	Disease (NF2)	---	B/D	L	141	P
09	UniProt	VAR_043013	G	197	C	MERL_HUMAN	Disease (NF2)	---	B	G	197	C
10	UniProt	VAR_000817	V	219	M	MERL_HUMAN	Unclassified	---	B/D	V	219	M
11	UniProt	VAR_000818	N	220	Y	MERL_HUMAN	Disease (NF2)	---	B/D	N	220	Y
12	UniProt	VAR_009123	L	234	R	MERL_HUMAN	Disease (NF2)	---	B/D	L	234	R
13	UniProt	VAR_000819	I	273	F	MERL_HUMAN	Unclassified	---	B/D	I	273	F

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (3, 12)

Exons (10, 40)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:260
 aligned with MERL_HUMAN | P35240 from UniProtKB/Swiss-Prot  Length:595

    Alignment length:293
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309   
           MERL_HUMAN    20 KTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRK 312
               SCOP domains d3u8za1 A:20-103 automated matches                                                  -------------------------------------------------                         -------------------------------------d3u8za2 A:215-312 automated matches                                                                SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee....eeeeeee...hhhhhhhhhhhhh...hhh.eeeeeee..eeee........--------.eeeeeee.....hhhhhh.hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh..-------------------------..hhhhhhhhhhhhhhhh.....hhhhhhhhhhhh.......eeeeeee....eeeeee...eeeee.........eeee...eeeeeee..eeeeee.......eeee..hhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------R---------------S--------------V-E--------------------------G----------I---------------R-------P-------------------------------------------------------C---------------------MY-------------R--------------------------------------F--------------------------------------- SAPs(SNPs)
                PROSITE (1) --FERM_3  PDB: A:22-311 UniProt: 22-311                                                                                                                                                                                                                                                             - PROSITE (1)
                PROSITE (2) ------------------------------------------------------FERM_1  PDB: A:74-104          ---------------------------------------------------------------------------------------FERM_2  PDB: A:192-221        ------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.1b          Exon 1.2  PDB: A:39-80 UniProt: 39-80     Exon 1.3  PDB: A:81-121 (gaps)           Exon 1.4  PDB: A:122-149    Exon 1.5  PDB: A:150-15Exon 1.6  PDB: A:178-200    -------------------------Exon 1.8  PDB: A:226-270 UniProt: 226-270    Exon 1.9  PDB: A:271-295 Exon 1.10         Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.7  PDB: A:200-225  --------------------------------------------------------------------------------------- Transcript 1 (2)
                 3u8z A  20 KTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVL--------PVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGD-------------------------QMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRK 312
                                    29        39        49        59        69        79  |      - |      99       109       119       129       139       149  |      -         -       179       189       199       209       219       229       239       249       259       269       279       289       299       309   
                                                                                         82       91                                                          152                       178

Chain B from PDB  Type:PROTEIN  Length:260
 aligned with MERL_HUMAN | P35240 from UniProtKB/Swiss-Prot  Length:595

    Alignment length:293
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309   
           MERL_HUMAN    20 KTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRK 312
               SCOP domains d3u8zb1 B:20-103 automated matches                                                  -------------------------------------------------                         -------------------------------------d3u8zb2 B:215-312 automated matches                                                                SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee....eeeeeee...hhhhhhhhhhhhh...hhh.eeeeeee..eeee........--------.eeeeeee.....hhhhhh.hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh..-------------------------..hhhhhhhhhhhhhhhh.....hhhhhhhhhhhh.......eeeeeee....eeeeee...eeeee.........eeee...eeeeeee..eeeeee.......eeee..hhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------R---------------S--------------V-E--------------------------G----------I---------------R-------P-------------------------------------------------------C---------------------MY-------------R--------------------------------------F--------------------------------------- SAPs(SNPs)
                PROSITE (1) --FERM_3  PDB: B:22-311 UniProt: 22-311                                                                                                                                                                                                                                                             - PROSITE (1)
                PROSITE (2) ------------------------------------------------------FERM_1  PDB: B:74-104          ---------------------------------------------------------------------------------------FERM_2  PDB: B:192-221        ------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.1b          Exon 1.2  PDB: B:39-80 UniProt: 39-80     Exon 1.3  PDB: B:81-121 (gaps)           Exon 1.4  PDB: B:122-149    Exon 1.5  PDB: B:150-15Exon 1.6  PDB: B:178-200    -------------------------Exon 1.8  PDB: B:226-270 UniProt: 226-270    Exon 1.9  PDB: B:271-295 Exon 1.10         Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.7  PDB: B:200-225  --------------------------------------------------------------------------------------- Transcript 1 (2)
                 3u8z B  20 KTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVL--------PVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGD-------------------------QMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRK 312
                                    29        39        49        59        69        79  |      - |      99       109       119       129       139       149  |      -         -       179       189       199       209       219       229       239       249       259       269       279       289       299       309   
                                                                                         82       91                                                          152                       178

Chain C from PDB  Type:PROTEIN  Length:266
 aligned with MERL_HUMAN | P35240 from UniProtKB/Swiss-Prot  Length:595

    Alignment length:293
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309   
           MERL_HUMAN    20 KTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRK 312
               SCOP domains d3u8zc1 C:20-103 automated matches                                                  d3u8zc2 C:104-214 automated matches                                                                            d3u8zc3 C:215-312 automated matches                                                                SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee...eeeeeeee...hhhhhhhhhhhhh...hhh.eeeeeee..eeee........--------.eeeeeee.....hhhhhh.hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh.......-------------------..hhhhhhhhhhhhhhhh.....hhhhhhhhhhhh.......eeeeeee....eeeeee...eeeee.........eeee...eeeeeee..eeeeee.......eeee..hhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------R---------------S--------------V-E--------------------------G----------I---------------R-------P-------------------------------------------------------C---------------------MY-------------R--------------------------------------F--------------------------------------- SAPs(SNPs)
                PROSITE (1) --FERM_3  PDB: C:22-311 UniProt: 22-311                                                                                                                                                                                                                                                             - PROSITE (1)
                PROSITE (2) ------------------------------------------------------FERM_1  PDB: C:74-104          ---------------------------------------------------------------------------------------FERM_2  PDB: C:192-221        ------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.1b          Exon 1.2  PDB: C:39-80 UniProt: 39-80     Exon 1.3  PDB: C:81-121 (gaps)           Exon 1.4  PDB: C:122-149    Exon 1.5  PDB: C:150-15Exon 1.6  PDB: C:178-200    -------------------------Exon 1.8  PDB: C:226-270 UniProt: 226-270    Exon 1.9  PDB: C:271-295 Exon 1.10         Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.7  PDB: C:200-225  --------------------------------------------------------------------------------------- Transcript 1 (2)
                 3u8z C  20 KTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVL--------PVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVH-------------------QMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRK 312
                                    29        39        49        59        69        79  |      - |      99       109       119       129       139       149        |-         -       179       189       199       209       219       229       239       249       259       269       279       289       299       309   
                                                                                         82       91                                                                158                 178

Chain D from PDB  Type:PROTEIN  Length:237
 aligned with MERL_HUMAN | P35240 from UniProtKB/Swiss-Prot  Length:595

    Alignment length:293
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309   
           MERL_HUMAN    20 KTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRK 312
               SCOP domains d3u8zd1 D:20-103 automated matches                                                  -----------------------------------------------                                                ----------------d3u8zd2 D:215-312 automated matches                                                                SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee....eeeeeee...hhhhhhhhhhhhh...hhh.eeeeeee..eeee........--------.eeeeeee.....hhhhhh.hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh------------------------------------------------.hhhhhhhhhhhhh.......eeeeeee....eeeeee...eeeee.........eeee...eeeeeee..eeeeee.......eeee..hhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------R---------------S--------------V-E--------------------------G----------I---------------R-------P-----------------------------------------------------------------------------MY-------------R--------------------------------------F--------------------------------------- SAPs(SNPs)
                PROSITE (1) --FERM_3  PDB: D:22-311 UniProt: 22-311                                                                                                                                                                                                                                                             - PROSITE (1)
                PROSITE (2) ------------------------------------------------------FERM_1  PDB: D:74-104          ---------------------------------------------------------------------------------------FERM_2  PDB: D:199-221        ------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.1b          Exon 1.2  PDB: D:39-80 UniProt: 39-80     Exon 1.3  PDB: D:81-121 (gaps)           Exon 1.4  PDB: D:122-149    Exon 1.5  PDB: D:150-15Exon 1.6  PDB: D:199-200    -------------------------Exon 1.8  PDB: D:226-270 UniProt: 226-270    Exon 1.9  PDB: D:271-295 Exon 1.10         Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.7  PDB: D:200-225  --------------------------------------------------------------------------------------- Transcript 1 (2)
                 3u8z D  20 KTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVL--------PVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKY------------------------------------------------ARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRK 312
                                    29        39        49        59        69        79  |      - |      99       109       119       129       139       149|        -         -         -         -       199       209       219       229       239       249       259       269       279       289       299       309   
                                                                                         82       91                                                        150                                              199

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (3, 9)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (58, 58)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (MERL_HUMAN | P35240)

molecular function
	GO:0003779	actin binding	Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
	GO:0008013	beta-catenin binding	Interacting selectively and non-covalently with the beta subunit of the catenin complex.
	GO:0008092	cytoskeletal protein binding	Interacting selectively and non-covalently with any protein component of any cytoskeleton (actin, microtubule, or intermediate filament cytoskeleton).
	GO:0005178	integrin binding	Interacting selectively and non-covalently with an integrin.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0019904	protein domain specific binding	Interacting selectively and non-covalently with a specific domain of a protein.
biological process
	GO:0014010	Schwann cell proliferation	The multiplication or reproduction of Schwann cells, resulting in the expansion of their population. Schwann cells are a type of glial cell in the peripheral nervous system.
	GO:0030036	actin cytoskeleton organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments and their associated proteins.
	GO:0007420	brain development	The process whose specific outcome is the progression of the brain over time, from its formation to the mature structure. Brain development begins with patterning events in the neural tube and ends with the mature structure that is the center of thought and emotion. The brain is responsible for the coordination and control of bodily activities and the interpretation of information from the senses (sight, hearing, smell, etc.).
	GO:0045216	cell-cell junction organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a cell-cell junction. A cell-cell junction is a specialized region of connection between two cells.
	GO:0007398	ectoderm development	The process whose specific outcome is the progression of the ectoderm over time, from its formation to the mature structure. In animal embryos, the ectoderm is the outer germ layer of the embryo, formed during gastrulation.
	GO:0021766	hippocampus development	The progression of the hippocampus over time from its initial formation until its mature state.
	GO:0070306	lens fiber cell differentiation	The process in which a relatively unspecialized cell acquires specialized features of a lens fiber cell, any of the elongated, tightly packed cells that make up the bulk of the mature lens in the camera-type eye. The cytoplasm of a lens fiber cell is devoid of most intracellular organelles including the cell nucleus, and contains primarily crystallins, a group of water-soluble proteins expressed in vary large quantities.
	GO:0001707	mesoderm formation	The process that gives rise to the mesoderm. This process pertains to the initial formation of the structure from unspecified parts.
	GO:0008156	negative regulation of DNA replication	Any process that stops, prevents, or reduces the frequency, rate or extent of DNA replication.
	GO:0046426	negative regulation of JAK-STAT cascade	Any process that stops, prevents, or reduces the frequency, rate or extent of the JAK-STAT signaling pathway activity.
	GO:0043409	negative regulation of MAPK cascade	Any process that stops, prevents, or reduces the frequency, rate or extent of signal transduction mediated by the MAPKKK cascade.
	GO:0030308	negative regulation of cell growth	Any process that stops, prevents, or reduces the frequency, rate, extent or direction of cell growth.
	GO:0030336	negative regulation of cell migration	Any process that stops, prevents, or reduces the frequency, rate or extent of cell migration.
	GO:0008285	negative regulation of cell proliferation	Any process that stops, prevents or reduces the rate or extent of cell proliferation.
	GO:0022408	negative regulation of cell-cell adhesion	Any process that stops, prevents or reduces the rate or extent of cell adhesion to another cell.
	GO:0001953	negative regulation of cell-matrix adhesion	Any process that stops, prevents, or reduces the rate or extent of cell adhesion to the extracellular matrix.
	GO:0006469	negative regulation of protein kinase activity	Any process that stops, prevents, or reduces the frequency, rate or extent of protein kinase activity.
	GO:0042475	odontogenesis of dentin-containing tooth	The process whose specific outcome is the progression of a dentin-containing tooth over time, from its formation to the mature structure. A dentin-containing tooth is a hard, bony organ borne on the jaw or other bone of a vertebrate, and is composed mainly of dentin, a dense calcified substance, covered by a layer of enamel.
	GO:0045597	positive regulation of cell differentiation	Any process that activates or increases the frequency, rate or extent of cell differentiation.
	GO:0051496	positive regulation of stress fiber assembly	Any process that activates or increases the frequency, rate or extent of the assembly of a stress fiber, a bundle of microfilaments and other proteins found in fibroblasts.
	GO:0042127	regulation of cell proliferation	Any process that modulates the frequency, rate or extent of cell proliferation.
	GO:0014013	regulation of gliogenesis	Any process that modulates the frequency, rate or extent of gliogenesis, the formation of mature glia.
	GO:0035330	regulation of hippo signaling	Any process that modulates the frequency, rate or extent of hippo signaling.
	GO:2000177	regulation of neural precursor cell proliferation	Any process that modulates the frequency, rate or extent of neural precursor cell proliferation.
	GO:0050767	regulation of neurogenesis	Any process that modulates the frequency, rate or extent of neurogenesis, the origin and formation of neurons.
	GO:1900180	regulation of protein localization to nucleus	Any process that modulates the frequency, rate or extent of protein localization to nucleus.
	GO:0031647	regulation of protein stability	Any process that affects the structure and integrity of a protein, altering the likelihood of its degradation or aggregation.
	GO:0072091	regulation of stem cell proliferation	Any process that modulates the frequency, rate or extent of stem cell proliferation. A stem cell is a cell that retains the ability to divide and proliferate throughout life to provide progenitor cells that can differentiate into specialized cells.
cellular component
	GO:0005912	adherens junction	A cell junction at which anchoring proteins (cadherins or integrins) extend through the plasma membrane and are attached to actin filaments.
	GO:0045177	apical part of cell	The region of a polarized cell that forms a tip or is distal to a base. For example, in a polarized epithelial cell, the apical region has an exposed surface and lies opposite to the basal lamina that separates the epithelium from other tissue.
	GO:0044297	cell body	The portion of a cell bearing surface projections such as axons, dendrites, cilia, or flagella that includes the nucleus, but excludes all cell projections.
	GO:0042995	cell projection	A prolongation or process extending from a cell, e.g. a flagellum or axon.
	GO:0032154	cleavage furrow	The cleavage furrow is a plasma membrane invagination at the cell division site. The cleavage furrow begins as a shallow groove and eventually deepens to divide the cytoplasm.
	GO:0030864	cortical actin cytoskeleton	The portion of the actin cytoskeleton, comprising filamentous actin and associated proteins, that lies just beneath the plasma membrane.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0005769	early endosome	A membrane-bounded organelle that receives incoming material from primary endocytic vesicles that have been generated by clathrin-dependent and clathrin-independent endocytosis; vesicles fuse with the early endosome to deliver cargo for sorting into recycling or degradation pathways.
	GO:0019898	extrinsic component of membrane	The component of a membrane consisting of gene products and protein complexes that are loosely bound to one of its surfaces, but not integrated into the hydrophobic region.
	GO:0030175	filopodium	Thin, stiff, actin-based protrusion extended by the leading edge of a motile cell such as a crawling fibroblast or amoeba, or an axonal or dendritic growth cone, or a dendritic shaft.
	GO:0031527	filopodium membrane	The portion of the plasma membrane surrounding a filopodium.
	GO:0030027	lamellipodium	A thin sheetlike process extended by the leading edge of a migrating cell or extending cell process; contains a dense meshwork of actin filaments.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0045121	membrane raft	Any of the small (10-200 nm), heterogeneous, highly dynamic, sterol- and sphingolipid-enriched membrane domains that compartmentalize cellular processes. Small rafts can sometimes be stabilized to form larger platforms through protein-protein and protein-lipid interactions.
	GO:0043005	neuron projection	A prolongation or process extending from a nerve cell, e.g. an axon or dendrite.
	GO:0005730	nucleolus	A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0048471	perinuclear region of cytoplasm	Cytoplasm situated near, or occurring around, the nucleus.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
	GO:0001726	ruffle	Projection at the leading edge of a crawling cell; the protrusions are supported by a microfilament meshwork.
	GO:0032587	ruffle membrane	The portion of the plasma membrane surrounding a ruffle.
	GO:0045202	synapse	The junction between a nerve fiber of one neuron and another neuron, muscle fiber or glial cell. As the nerve fiber approaches the synapse it enlarges into a specialized structure, the presynaptic nerve ending, which contains mitochondria and synaptic vesicles. At the tip of the nerve ending is the presynaptic membrane; facing it, and separated from it by a minute cleft (the synaptic cleft) is a specialized area of membrane on the receiving cell, known as the postsynaptic membrane. In response to the arrival of nerve impulses, the presynaptic nerve ending secretes molecules of neurotransmitters into the synaptic cleft. These diffuse across the cleft and transmit the signal to the postsynaptic membrane.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (13, 51)

PROSITE Motifs (3, 12)

Exons (10, 40)

Sequences/Alignments

Classification and Annotation

SCOP Domains (3, 9)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (58, 58)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File