Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  1.60 ANGSTROM RESOLUTION CRYSTAL STRUCTURE OF A 3-DEHYDROQUINATE DEHYDRATASE-LIKE PROTEIN FROM BIFIDOBACTERIUM LONGUM
 
Authors :  S. H. Light, G. Minasov, L. Shuvalova, L. Papazisi, A. Lavie, W. F. Ander Center For Structural Genomics Of Infectious Diseases (Csgi
Date :  14 Oct 11  (Deposition) - 26 Oct 11  (Release) - 08 May 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.60
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Structural Genomics, Center For Structural Genomics Of Infectious Diseases, Csgid, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. H. Light, S. N. Krishna, R. C. Bergan, A. Lavie, W. F. Anderson
Crystal Structure Of A Type Ii Dehydroquinate Dehydratase-Like Protein From Bifidobacterium Longum.
J. Struct. Funct. Genom. V. 14 25 2013
PubMed-ID: 23539270  |  Reference-DOI: 10.1007/S10969-013-9149-7

(-) Compounds

Molecule 1 - 3-DEHYDROQUINATE DEHYDRATASE, TYPE II
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPMCSG7
    Expression System StrainBL21
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneBLJ_0876
    Organism ScientificBIFIDOBACTERIUM LONGUM
    Organism Taxid759350
    StrainJDM301

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3U80)

(-) Sites  (0, 0)

(no "Site" information available for 3U80)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3U80)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3U80)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3U80)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3U80)

(-) Exons   (0, 0)

(no "Exon" information available for 3U80)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:127
 aligned with D6ZTY6_BIFLJ | D6ZTY6 from UniProtKB/TrEMBL  Length:148

    Alignment length:148
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140        
         D6ZTY6_BIFLJ     1 MTKVIVVNGPNLGRLGVRQPDVYGRQDLDTLRKLCAEWGKDLGLEVEVRQTDDEAEMVRWMHQAADEKTPVVMNPAAFTHYSYALADAAHMVIDENLPLMEVHISNPSARDEFRKRSVISPVATGTITGMGFYGYKLALDAVAHLLSE 148
               SCOP domains d3u80a_ A: a            utomated matches                                                                                                             SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee....------------.hhhhhhhhhhhhhhhhh.eeeeeee..hhhhhhhhhhhhhhhh..eeee.......hhhhhhhhhhhhhh...eeeee....---------........eeee...hhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3u80 A   1 MTKVIVVNGPNL------------RQDLDTLRKLCAEWGKDLGLEVEVRQTDDEAEMVRWMHQAADEKTPVVMNPAAFTHYSYALADAAHMVIDENLPLMEVHISNP---------SVISPVATGTITGMGFYGYKLALDAVAHLLSE 148
                                    10 |       -    |   30        40        50        60        70        80        90       100      |  -      |120       130       140        
                                      12           25                                                                               107       117                               

Chain B from PDB  Type:PROTEIN  Length:123
 aligned with D6ZTY6_BIFLJ | D6ZTY6 from UniProtKB/TrEMBL  Length:148

    Alignment length:148
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140        
         D6ZTY6_BIFLJ     1 MTKVIVVNGPNLGRLGVRQPDVYGRQDLDTLRKLCAEWGKDLGLEVEVRQTDDEAEMVRWMHQAADEKTPVVMNPAAFTHYSYALADAAHMVIDENLPLMEVHISNPSARDEFRKRSVISPVATGTITGMGFYGYKLALDAVAHLLSE 148
               SCOP domains d3u80b_ B:               automated matches                                                                                                           SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee...--------------.hhhhhhhhhhhhhhhh.eeeeeee..hhhhhhhhhhhhhhhh..eeee.......hhhhhhhhhhhhhh...eeeee.......-----------...eeee...hhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3u80 B   1 MTKVIVVNGPN--------------QDLDTLRKLCAEWGKDLGLEVEVRQTDDEAEMVRWMHQAADEKTPVVMNPAAFTHYSYALADAAHMVIDENLPLMEVHISNPSAR-----------VATGTITGMGFYGYKLALDAVAHLLSE 148
                                    10|        -     |  30        40        50        60        70        80        90       100       110         - |     130       140        
                                     11             26                                                                                 110         122                          

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3U80)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3U80)

(-) Gene Ontology  (5, 5)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (D6ZTY6_BIFLJ | D6ZTY6)
molecular function
    GO:0003855    3-dehydroquinate dehydratase activity    Catalysis of the reaction: 3-dehydroquinate = 3-dehydroshikimate + H(2)O.
    GO:0016829    lyase activity    Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
biological process
    GO:0009073    aromatic amino acid family biosynthetic process    The chemical reactions and pathways resulting in the formation of aromatic amino acid family, amino acids with aromatic ring (phenylalanine, tyrosine, tryptophan).
    GO:0008652    cellular amino acid biosynthetic process    The chemical reactions and pathways resulting in the formation of amino acids, organic acids containing one or more amino substituents.
    GO:0009423    chorismate biosynthetic process    The chemical reactions and pathways resulting in the formation of the unsymmetrical ether derived from phosphoenolpyruvate and 5-phosphoshikimic acid formed as an intermediate in the biosynthesis of aromatic amino acids and many other compounds.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3u80)
 
  Sites
(no "Sites" information available for 3u80)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3u80)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3u80
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  D6ZTY6_BIFLJ | D6ZTY6
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  D6ZTY6_BIFLJ | D6ZTY6
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3U80)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3U80)