Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  THE CRYSTAL STRUCTURE OF 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE FROM SINORHIZOBIUM MELILOTI
 
Authors :  Z. Zhang, S. Chamala, B. Evans, R. Foti, A. Gizzi, B. Hillerich, A. Kar, J R. Seidel, G. Villigas, W. Zencheck, S. C. Almo, S. Swaminathan, New Y Structural Genomics Research Consortium (Nysgrc)
Date :  11 Oct 11  (Deposition) - 09 Nov 11  (Release) - 09 Nov 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.40
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,C  (2x)
Biol. Unit 2:  A,C  (1x)
Biol. Unit 3:  B,D  (2x)
Biol. Unit 4:  B,D  (1x)
Keywords :  Structural Genomics, Psi-Biology, New York Structural Genomics Research Consortium, Nysgrc, 3-Oxoacyl, Acyl-Carrier-Protein, Reductase, Sino Protein, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Z. Zhang, S. C. Almo, S. Swaminathan
The Crystal Structure Of 3-Oxoacyl-[Acyl-Carrier-Protein] Reductase From Sinorhizobium Meliloti
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - 3-OXOACYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
    Chains: A, B, C, D
    EC Number: 1.1.1.100
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: RB0475, SM_B20493
    Organism Common: ENSIFER MELILOTI
    Organism Scientific: SINORHIZOBIUM MELILOTI
    Organism Taxid: 382

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (2x): A C 
Biological Unit 2 (1x): A C 
Biological Unit 3 (2x):  B D
Biological Unit 4 (1x):  B D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 12)

Asymmetric Unit (1, 12)
No.NameCountTypeFull Name
1MSE12Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (1, 12)
No.NameCountTypeFull Name
1MSE12Mod. Amino AcidSELENOMETHIONINE
Biological Unit 2 (1, 6)
No.NameCountTypeFull Name
1MSE6Mod. Amino AcidSELENOMETHIONINE
Biological Unit 3 (1, 12)
No.NameCountTypeFull Name
1MSE12Mod. Amino AcidSELENOMETHIONINE
Biological Unit 4 (1, 6)
No.NameCountTypeFull Name
1MSE6Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 3U5T)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3U5T)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3U5T)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3U5T)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3U5T)

(-) Exons   (0, 0)

(no "Exon" information available for 3U5T)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:230
 aligned with Q92W70_RHIME | Q92W70 from UniProtKB/TrEMBL  Length:244

    Alignment length:241
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243 
         Q92W70_RHIME     4 NKVAIVTGASRGIGAAIAARLASDGFTVVINYAGKAAAAEEVAGKIEAAGGKALTAQADVSDPAAVRRLFATAEEAFGGVDVLVNNAGIMPLTTIAETGDAVFDRVIAVNLKGTFNTLREAAQRLRVGGRIINMSTSQVGLLHPSYGIYAAAKAGVEAMTHVLSKELRGRDITVNAVAPGPTATDLFLEGKSDEVRDRFAKLAPLERLGTPQDIAGAVAFLAGPDGAWVNGQVLRANGGII 244
               SCOP domains d3u5ta_ A: automated matches                                                                                                                                                                                                                      SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee...hhhhhhhhhhhhhhh.eeeeee...hhhhhhhhhhhhhh...eeeee....hhhhhhhhhhhhhhhhh.eeeeee........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhheeeeeeeeee..hhhhhh...hhhhhhhhhhhhhhhhhhhhhh.....eeeeeee....-----------.hhhhhh........hhhhhhhhhhhhhh........eeeee..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3u5t A   4 NKVAIVTGASRGIGAAIAARLASDGFTVVINYAGKAAAAEEVAGKIEAAGGKALTAQADVSDPAAVRRLFATAEEAFGGVDVLVNNAGImPLTTIAETGDAVFDRVIAVNLKGTFNTLREAAQRLRVGGRIINmSTSQVGLLHPSYGIYAAAKAGVEAmTHVLSKELRGRDITVNAVAPGPTA-----------VRDRFAKLAPLERLGTPQDIAGAVAFLAGPDGAWVNGQVLRANGGII 244
                                    13        23        33        43        53        63        73        83        93       103       113       123       133   |   143       153       163       173       183  |      -    |  203       213       223       233       243 
                                                                                                                    93-MSE                                     137-MSE                  162-MSE                 186         198                                              


Chain B from PDB  Type:PROTEIN  Length:233
 aligned with Q92W70_RHIME | Q92W70 from UniProtKB/TrEMBL  Length:244

    Alignment length:241
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243 
         Q92W70_RHIME     4 NKVAIVTGASRGIGAAIAARLASDGFTVVINYAGKAAAAEEVAGKIEAAGGKALTAQADVSDPAAVRRLFATAEEAFGGVDVLVNNAGIMPLTTIAETGDAVFDRVIAVNLKGTFNTLREAAQRLRVGGRIINMSTSQVGLLHPSYGIYAAAKAGVEAMTHVLSKELRGRDITVNAVAPGPTATDLFLEGKSDEVRDRFAKLAPLERLGTPQDIAGAVAFLAGPDGAWVNGQVLRANGGII 244
               SCOP domains d3u5tb_ B: automated matches                                                                                                                                                                                                                      SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee...hhhhhhhhhhhhhh..eeeeee...hhhhhhhhhhhhhh...eeeee....hhhhhhhhhhhhhhhhh...eeee........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeee..hhhhhh...hhhhhhhhhhhhhhhhhhhhhh.....eeeeeee.......--------.hhhhhh........hhhhhhhhhhhhhhhhhh.....eeee..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3u5t B   4 NKVAIVTGASRGIGAAIAARLASDGFTVVINYAGKAAAAEEVAGKIEAAGGKALTAQADVSDPAAVRRLFATAEEAFGGVDVLVNNAGImPLTTIAETGDAVFDRVIAVNLKGTFNTLREAAQRLRVGGRIINmSTSQVGLLHPSYGIYAAAKAGVEAmTHVLSKELRGRDITVNAVAPGPTATDL--------VRDRFAKLAPLERLGTPQDIAGAVAFLAGPDGAWVNGQVLRANGGII 244
                                    13        23        33        43        53        63        73        83        93       103       113       123       133   |   143       153       163       173       183     |   -    |  203       213       223       233       243 
                                                                                                                    93-MSE                                     137-MSE                  162-MSE                    189      198                                              


Chain C from PDB  Type:PROTEIN  Length:214
 aligned with Q92W70_RHIME | Q92W70 from UniProtKB/TrEMBL  Length:244

    Alignment length:239
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235         
         Q92W70_RHIME     6 VAIVTGASRGIGAAIAARLASDGFTVVINYAGKAAAAEEVAGKIEAAGGKALTAQADVSDPAAVRRLFATAEEAFGGVDVLVNNAGIMPLTTIAETGDAVFDRVIAVNLKGTFNTLREAAQRLRVGGRIINMSTSQVGLLHPSYGIYAAAKAGVEAMTHVLSKELRGRDITVNAVAPGPTATDLFLEGKSDEVRDRFAKLAPLERLGTPQDIAGAVAFLAGPDGAWVNGQVLRANGGII 244
               SCOP domains d3u5tc   _ C: automated matches                                                                                                                                                                                                                 SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee..---.hhhhhhhhhhhhh..eee...----.hhhhhhhhhhh...---......--.hhhhhhhhhhhhh....eee..............hhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeee..hhhhhh...hhhhhhhhhhhhhhhhhhhhhh.....eeeeeee...-------------..............hhhhhhhhhhhhhhhhhh.....eeee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3u5t C   6 VAIVTG---GIGAAIAARLASDGFTVVINYA----AAEEVAGKIEAAGGK---AQADVS--AAVRRLFATAEEAFGGVDVLVNNAGImPLTTIAETGDAVFDRVIAVNLKGTFNTLREAAQRLRVGGRIINmSTSQVGLLHPSYGIYAAAKAGVEAmTHVLSKELRGRDITVNAVAPGPT-------------RDRFAKLAPLERLGTPQDIAGAVAFLAGPDGAWVNGQVLRANGGII 244
                                 |  15        25        35|    |  45        55   |    |- |      75        85       |95       105       115       125       135 |     145       155      |165       175       185         -   |   205       215       225       235         
                                11  15                   36   41            55  59   64 67                        93-MSE                                     137-MSE                  162-MSE                185           199                                             


Chain D from PDB  Type:PROTEIN  Length:228
 aligned with Q92W70_RHIME | Q92W70 from UniProtKB/TrEMBL  Length:244

    Alignment length:240
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244
         Q92W70_RHIME     5 KVAIVTGASRGIGAAIAARLASDGFTVVINYAGKAAAAEEVAGKIEAAGGKALTAQADVSDPAAVRRLFATAEEAFGGVDVLVNNAGIMPLTTIAETGDAVFDRVIAVNLKGTFNTLREAAQRLRVGGRIINMSTSQVGLLHPSYGIYAAAKAGVEAMTHVLSKELRGRDITVNAVAPGPTATDLFLEGKSDEVRDRFAKLAPLERLGTPQDIAGAVAFLAGPDGAWVNGQVLRANGGII 244
               SCOP domains d3u5td_ D: automated matches                                                                                                                                                                                                                     SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeee...hhhhhhhhhhhhhh..eeeeee...hhhhhhhhhhhhh....eeeee....hhhhhhhhhhhhhhhhh...eeee........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeee..hhhhhh...hhhhhhhhhhhhhhhhhhhhhh.....eeeeeee...------------.hhhhhh........hhhhhhhhhhhhh..........eeee..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3u5t D   5 KVAIVTGASRGIGAAIAARLASDGFTVVINYAGKAAAAEEVAGKIEAAGGKALTAQADVSDPAAVRRLFATAEEAFGGVDVLVNNAGImPLTTIAETGDAVFDRVIAVNLKGTFNTLREAAQRLRVGGRIINmSTSQVGLLHPSYGIYAAAKAGVEAmTHVLSKELRGRDITVNAVAPGPT------------VRDRFAKLAPLERLGTPQDIAGAVAFLAGPDGAWVNGQVLRANGGII 244
                                    14        24        34        44        54        64        74        84        94       104       114       124       134  |    144       154       164       174       184|        -   |   204       214       224       234       244
                                                                                                                   93-MSE                                     137-MSE                  162-MSE                185          198
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3U5T)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3U5T)

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (Q92W70_RHIME | Q92W70)
molecular function
    GO:0004316    3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity    Catalysis of the reaction: (3R)-3-hydroxyacyl-[acyl-carrier protein] + NADP+ = 3-oxoacyl-[acyl-carrier protein] + NADPH + H+.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3u5t)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3u5t)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format | Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3u5t
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q92W70_RHIME | Q92W70
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  1.1.1.100
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q92W70_RHIME | Q92W70
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3U5T)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3U5T)