Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF THE 2-METHYLCITRATE SYNTHASE (PRPC) FROM COXIELLA BURNETII
 
Authors :  M. C. Franklin, J. Cheung, M. Rudolph, M. Cassidy, E. Gary, F. Burshteyn
Date :  09 Sep 11  (Deposition) - 28 Sep 11  (Release) - 20 Jan 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Energy Metabolism, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. C. Franklin, J. Cheung, M. J. Rudolph, F. Burshteyn, M. Cassidy, E. Gary, B. Hillerich, Z. K. Yao, P. R. Carlier, M. Totrov, J. D. Love
Structural Genomics For Drug Design Against The Pathogen Coxiella Burnetii.
Proteins V. 83 2124 2015
PubMed-ID: 26033498  |  Reference-DOI: 10.1002/PROT.24841

(-) Compounds

Molecule 1 - 2-METHYLCITRATE SYNTHASE
    Chains: A, B
    EC Number: 2.3.3.5
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: CBU_0772, PRPC
    Organism Scientific: COXIELLA BURNETII
    Organism Taxid: 777
    Strain: RSA 493 NINE MILE PHASE I

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 20)

Asymmetric/Biological Unit (1, 20)
No.NameCountTypeFull Name
1MSE20Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 3TQG)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3TQG)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3TQG)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3TQG)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3TQG)

(-) Exons   (0, 0)

(no "Exon" information available for 3TQG)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:360
 aligned with Q83DG4_COXBU | Q83DG4 from UniProtKB/TrEMBL  Length:372

    Alignment length:360
                                    22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372
         Q83DG4_COXBU    13 AGETSIATVGKEGHGLTYRGYRIEDLAANATFEEVAYLLLKNKLPTKSELDAYTKKLVNLRSLPPALKDTLERIPASSHPMDVMRTGCSMLGNLEPENGFENEQNIADRLVAIFPAIQCYWYHYSHHGKRIDTELDDLTLAGYFLHLLLGKKAAQMAIDCMNASLILYAEHEFNASTFAARVCSATLSDIYSAVTAAIATLRGPLHGGANEAAMDLIMLYKTPSEAIAGIKRKLANKELIMGFGHAVYRERDPRNAIIKSWAQKLAPNAADGYLFDISDAIENTMQDEKKLFPNLDFYSATAYHFLNIPTKLFTPIFVMSRVTGWCAHIFEQRKDNRIIRPNADYIGPEEQGWVPIEKRR 372
               SCOP domains d3tqga_ A: automated matches                                                                                                                                                                                                                                                                                                                                             SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..ee..eee......eee..eehhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh....hhhhhhhhhh.....hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhh...hhhhhhhhhhhhhhhh....hhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh......eeee.........hhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3tqg A  13 AGETSIATVGKEGHGLTYRGYRIEDLAANATFEEVAYLLLKNKLPTKSELDAYTKKLVNLRSLPPALKDTLERIPASSHPmDVmRTGCSmLGNLEPENGFENEQNIADRLVAIFPAIQCYWYHYSHHGKRIDTELDDLTLAGYFLHLLLGKKAAQmAIDCmNASLILYAEHEFNASTFAARVCSATLSDIYSAVTAAIATLRGPLHGGANEAAmDLImLYKTPSEAIAGIKRKLANKELImGFGHAVYRERDPRNAIIKSWAQKLAPNAADGYLFDISDAIENTmQDEKKLFPNLDFYSATAYHFLNIPTKLFTPIFVmSRVTGWCAHIFEQRKDNRIIRPNADYIGPEEQGWVPIEKRR 372
                                    22        32        42        52        62        72        82        92|  |   102       112       122       132       142       152       162     | 172|      182       192       202       212       222   |   232       242       252|      262       272       282       292    |  302       312       322       332       342       352       362       372
                                                                                                           93-MSE    |                                                               168-MSE|                                                  226-MSE                    253-MSE                                     297-MSE                           331-MSE                                     
                                                                                                              96-MSE |                                                                    173-MSE                                                  230-MSE                                                                                                                                          
                                                                                                                   102-MSE                                                                                                                                                                                                                                                                          


Chain B from PDB  Type:PROTEIN  Length:362
 aligned with Q83DG4_COXBU | Q83DG4 from UniProtKB/TrEMBL  Length:372

    Alignment length:362
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370  
         Q83DG4_COXBU    11 QSAGETSIATVGKEGHGLTYRGYRIEDLAANATFEEVAYLLLKNKLPTKSELDAYTKKLVNLRSLPPALKDTLERIPASSHPMDVMRTGCSMLGNLEPENGFENEQNIADRLVAIFPAIQCYWYHYSHHGKRIDTELDDLTLAGYFLHLLLGKKAAQMAIDCMNASLILYAEHEFNASTFAARVCSATLSDIYSAVTAAIATLRGPLHGGANEAAMDLIMLYKTPSEAIAGIKRKLANKELIMGFGHAVYRERDPRNAIIKSWAQKLAPNAADGYLFDISDAIENTMQDEKKLFPNLDFYSATAYHFLNIPTKLFTPIFVMSRVTGWCAHIFEQRKDNRIIRPNADYIGPEEQGWVPIEKRR 372
               SCOP domains d3tqgb_ B: automated matches                                                                                                                                                                                                                                                                                                                                               SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee..ee........ee..eehhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh....hhhhhhhhh......hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhh...hhhhhhhhhhhhhhhh....hhhhhhhhhhhh...hhhhhhhhhhhhhh.....hhhhhhhhhhh...hhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh........ee.........hhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3tqg B  11 QSAGETSIATVGKEGHGLTYRGYRIEDLAANATFEEVAYLLLKNKLPTKSELDAYTKKLVNLRSLPPALKDTLERIPASSHPmDVmRTGCSmLGNLEPENGFENEQNIADRLVAIFPAIQCYWYHYSHHGKRIDTELDDLTLAGYFLHLLLGKKAAQmAIDCmNASLILYAEHEFNASTFAARVCSATLSDIYSAVTAAIATLRGPLHGGANEAAmDLImLYKTPSEAIAGIKRKLANKELImGFGHAVYRERDPRNAIIKSWAQKLAPNAADGYLFDISDAIENTmQDEKKLFPNLDFYSATAYHFLNIPTKLFTPIFVmSRVTGWCAHIFEQRKDNRIIRPNADYIGPEEQGWVPIEKRR 372
                                    20        30        40        50        60        70        80        90  |  | 100 |     110       120       130       140       150       160       170  |    180       190       200       210       220     | 230       240       250  |    260       270       280       290      |300       310       320       330|      340       350       360       370  
                                                                                                             93-MSE    |                                                               168-MSE|                                                  226-MSE                    253-MSE                                     297-MSE                           331-MSE                                     
                                                                                                                96-MSE |                                                                    173-MSE                                                  230-MSE                                                                                                                                          
                                                                                                                     102-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3TQG)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3TQG)

(-) Gene Ontology  (7, 7)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q83DG4_COXBU | Q83DG4)
molecular function
    GO:0016833    oxo-acid-lyase activity    Catalysis of the cleavage of a C-C bond by other means than by hydrolysis or oxidation, of a 3-hydroxy acid.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0016746    transferase activity, transferring acyl groups    Catalysis of the transfer of an acyl group from one compound (donor) to another (acceptor).
    GO:0046912    transferase activity, transferring acyl groups, acyl groups converted into alkyl on transfer    Catalysis of the transfer of an acyl group from one compound (donor) to another (acceptor), with the acyl group being converted into alkyl on transfer.
biological process
    GO:0019629    propionate catabolic process, 2-methylcitrate cycle    The chemical reactions and pathways resulting in the breakdown of propionate that occurs in the 2-methylcitrate cycle.
    GO:0006099    tricarboxylic acid cycle    A nearly universal metabolic pathway in which the acetyl group of acetyl coenzyme A is effectively oxidized to two CO2 and four pairs of electrons are transferred to coenzymes. The acetyl group combines with oxaloacetate to form citrate, which undergoes successive transformations to isocitrate, 2-oxoglutarate, succinyl-CoA, succinate, fumarate, malate, and oxaloacetate again, thus completing the cycle. In eukaryotes the tricarboxylic acid is confined to the mitochondria. See also glyoxylate cycle.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3tqg)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3tqg)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3tqg
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q83DG4_COXBU | Q83DG4
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.3.3.5
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q83DG4_COXBU | Q83DG4
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3TQG)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3TQG)