3SIV - JenaLib

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:128
 aligned with NH2L1_HUMAN | P55769 from UniProtKB/Swiss-Prot  Length:128

    Alignment length:128
                                    10        20        30        40        50        60        70        80        90       100       110       120        
          NH2L1_HUMAN     1 MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV 128
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............hhhhhhhhhhhhhhhhhh...eehhhhhhhhhhh..eeeeeee....hhhhhhhhhhhhhhh...eeee.hhhhhhhhh.......eeeee......hhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------N------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------RIBOSOMAL_L7AE    -------------------------------------- PROSITE
           Transcript 2 (1) 2Exon 2.6b  PDB: A:2-42 UniProt: 2-42     -------------------------------------------------------------------------------------- Transcript 2 (1)
           Transcript 2 (2) -----------------------------------------Exon 2.7e  PDB: A:42-128 UniProt: 42-128                                                Transcript 2 (2)
                 3siv A   1 MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV 128
                                    10        20        30        40        50        60        70        80        90       100       110       120

Chain B from PDB  Type:PROTEIN  Length:237
 aligned with PRP31_HUMAN | Q8WWY3 from UniProtKB/Swiss-Prot  Length:499

    Alignment length:248
                                    94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324        
          PRP31_HUMAN    85 EAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGNSLDKCKNNENLQQILTNATIMVVSVTASTTQGQQLSEEELERLEEACDMALELNASKHRIYEYVESRMSFIAPNLSIIIGASTAAKIMGVAGGLTNLSKMPACNIMLLGAQRKTLSGFSSTSVLPHTGYIYHSDIVQSLPPDLRRKAARLVAAKCTLAARVDSFHESTEGKVGYELKDEIERKFDKWQ 332
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhh.hhhhhhhhhhhhh.........hhhhhh..hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....-----------..........hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------E---------------------P-------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------NOP  PDB: B:215-332 UniProt: 215-333                                                                                   PROSITE
           Transcript 1 (1) Exon 1.5  PDB: B:85-108 --------------------------------Exon 1.7  PDB: B:141-176            --------------------------------------------------------Exon 1.9d  PDB: B:233-285 (gaps) UniProt: 233-285    Exon 1.10b  PDB: B:286-315    Exon 1.11c        Transcript 1 (1)
           Transcript 1 (2) -----------------------Exon 1.6  PDB: B:108-140         -----------------------------------Exon 1.8  PDB: B:176-233 UniProt: 176-233                 --------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3siv B  85 EAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGNSLDKCKNNENLQQILTNATIMVVSVTASTTQGQQLSEEELERLEEACDMALELNASKHRIYEYVESRMSFIAPNLSIIIGASTAAKIMGVAGGLTNLSKMPACNIMLLGAQ-----------VLPHTGYIYHSDIVQSLPPDLRRKAARLVAAKCTLAARVDSFHESTEGKVGYELKDEIERKFDKWQ 332
                                    94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254|        -  |    274       284       294       304       314       324        
                                                                                                                                                                                                    255         267

Chain C from PDB  Type:RNA  Length:32
                                                                
                 3siv C  26 UACUGUCCAAUGAGCGCAUAGUGAGGGCAGUA  57
                                    35        45        55

Chain D from PDB  Type:PROTEIN  Length:125
 aligned with NH2L1_HUMAN | P55769 from UniProtKB/Swiss-Prot  Length:128

    Alignment length:125
                                    13        23        33        43        53        63        73        83        93       103       113       123     
          NH2L1_HUMAN     4 ADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV 128
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........hhhhhhhhhhhhhhhhhh...eehhhhhhhhhhh..eeeeee.....hhhhhhhhhhhhhhh...eee..hhhhhhhhhh......eeeee......hhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------N------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------RIBOSOMAL_L7AE    -------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.6b  PDB: D:4-42 UniProt: 2-42   -------------------------------------------------------------------------------------- Transcript 2 (1)
           Transcript 2 (2) --------------------------------------Exon 2.7e  PDB: D:42-128 UniProt: 42-128                                                Transcript 2 (2)
                 3siv D   4 ADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV 128
                                    13        23        33        43        53        63        73        83        93       103       113       123

Chain E from PDB  Type:PROTEIN  Length:236
 aligned with PRP31_HUMAN | Q8WWY3 from UniProtKB/Swiss-Prot  Length:499

    Alignment length:247
                                    95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       
          PRP31_HUMAN    86 AAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGNSLDKCKNNENLQQILTNATIMVVSVTASTTQGQQLSEEELERLEEACDMALELNASKHRIYEYVESRMSFIAPNLSIIIGASTAAKIMGVAGGLTNLSKMPACNIMLLGAQRKTLSGFSSTSVLPHTGYIYHSDIVQSLPPDLRRKAARLVAAKCTLAARVDSFHESTEGKVGYELKDEIERKFDKWQ 332
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhh..hhhhhh.hhhhhh..hhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhh...-----------.....hhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------E---------------------P-------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------NOP  PDB: E:215-332 UniProt: 215-333                                                                                   PROSITE
           Transcript 1 (1) Exon 1.5  PDB: E:86-108--------------------------------Exon 1.7  PDB: E:141-176            --------------------------------------------------------Exon 1.9d  PDB: E:233-285 (gaps) UniProt: 233-285    Exon 1.10b  PDB: E:286-315    Exon 1.11c        Transcript 1 (1)
           Transcript 1 (2) ----------------------Exon 1.6  PDB: E:108-140         -----------------------------------Exon 1.8  PDB: E:176-233 UniProt: 176-233                 --------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3siv E  86 AAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGNSLDKCKNNENLQQILTNATIMVVSVTASTTQGQQLSEEELERLEEACDMALELNASKHRIYEYVESRMSFIAPNLSIIIGASTAAKIMGVAGGLTNLSKMPACNIMLLGAQ-----------VLPHTGYIYHSDIVQSLPPDLRRKAARLVAAKCTLAARVDSFHESTEGKVGYELKDEIERKFDKWQ 332
                                    95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255         - |     275       285       295       305       315       325       
                                                                                                                                                                                                   255         267

Chain F from PDB  Type:RNA  Length:32
                                                                
                 3siv F  26 UACUGUCCAAUGAGCGCAUAGUGAGGGCAGUA  57
                                    35        45        55

Chain G from PDB  Type:PROTEIN  Length:128
 aligned with NH2L1_HUMAN | P55769 from UniProtKB/Swiss-Prot  Length:128

    Alignment length:128
                                    10        20        30        40        50        60        70        80        90       100       110       120        
          NH2L1_HUMAN     1 MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV 128
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............hhhhhhhhhhhhhhhhhh..eeehhhhhhhhhhh..eeeeeee....hhhhhhhhhhhh......eeee.hhhhhhhhh.......eeeee......hhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------N------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------RIBOSOMAL_L7AE    -------------------------------------- PROSITE
           Transcript 2 (1) 2Exon 2.6b  PDB: G:2-42 UniProt: 2-42     -------------------------------------------------------------------------------------- Transcript 2 (1)
           Transcript 2 (2) -----------------------------------------Exon 2.7e  PDB: G:42-128 UniProt: 42-128                                                Transcript 2 (2)
                 3siv G   1 MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV 128
                                    10        20        30        40        50        60        70        80        90       100       110       120

Chain H from PDB  Type:PROTEIN  Length:235
 aligned with PRP31_HUMAN | Q8WWY3 from UniProtKB/Swiss-Prot  Length:499

    Alignment length:247
                                    95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       
          PRP31_HUMAN    86 AAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGNSLDKCKNNENLQQILTNATIMVVSVTASTTQGQQLSEEELERLEEACDMALELNASKHRIYEYVESRMSFIAPNLSIIIGASTAAKIMGVAGGLTNLSKMPACNIMLLGAQRKTLSGFSSTSVLPHTGYIYHSDIVQSLPPDLRRKAARLVAAKCTLAARVDSFHESTEGKVGYELKDEIERKFDKWQ 332
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...............hhhhhhh........................................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhh.....------------....hhhhhh......hhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------E---------------------P-------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------NOP  PDB: H:215-332 UniProt: 215-333                                                                                   PROSITE
           Transcript 1 (1) Exon 1.5  PDB: H:86-108--------------------------------Exon 1.7  PDB: H:141-176            --------------------------------------------------------Exon 1.9d  PDB: H:233-285 (gaps) UniProt: 233-285    Exon 1.10b  PDB: H:286-315    Exon 1.11c        Transcript 1 (1)
           Transcript 1 (2) ----------------------Exon 1.6  PDB: H:108-140         -----------------------------------Exon 1.8  PDB: H:176-233 UniProt: 176-233                 --------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3siv H  86 AAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGNSLDKCKNNENLQQILTNATIMVVSVTASTTQGQQLSEEELERLEEACDMALELNASKHRIYEYVESRMSFIAPNLSIIIGASTAAKIMGVAGGLTNLSKMPACNIMLLGAQ------------LPHTGYIYHSDIVQSLPPDLRRKAARLVAAKCTLAARVDSFHESTEGKVGYELKDEIERKFDKWQ 332
                                    95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255         -  |    275       285       295       305       315       325       
                                                                                                                                                                                                   255          268

Chain I from PDB  Type:RNA  Length:32
                                                                
                 3siv I  26 UACUGUCCAAUGAGCGCAUAGUGAGGGCAGUA  57
                                    35        45        55

Chain J from PDB  Type:PROTEIN  Length:126
 aligned with NH2L1_HUMAN | P55769 from UniProtKB/Swiss-Prot  Length:128

    Alignment length:126
                                    12        22        32        42        52        62        72        82        92       102       112       122      
          NH2L1_HUMAN     3 EADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV 128
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ............hhhhhhhhhhhhhhhhhh..eeehhhhhhhhhhh..eeeeeee....hhhhh.hhhhhhhhhh..eeee.hhhhhhhhh.......eeeee......hhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------N------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------RIBOSOMAL_L7AE    -------------------------------------- PROSITE
           Transcript 2 (1) Exon 2.6b  PDB: J:3-42 UniProt: 2-42    -------------------------------------------------------------------------------------- Transcript 2 (1)
           Transcript 2 (2) ---------------------------------------Exon 2.7e  PDB: J:42-128 UniProt: 42-128                                                Transcript 2 (2)
                 3siv J   3 EADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV 128
                                    12        22        32        42        52        62        72        82        92       102       112       122

Chain K from PDB  Type:PROTEIN  Length:241
 aligned with PRP31_HUMAN | Q8WWY3 from UniProtKB/Swiss-Prot  Length:499

    Alignment length:247
                                    95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       
          PRP31_HUMAN    86 AAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGNSLDKCKNNENLQQILTNATIMVVSVTASTTQGQQLSEEELERLEEACDMALELNASKHRIYEYVESRMSFIAPNLSIIIGASTAAKIMGVAGGLTNLSKMPACNIMLLGAQRKTLSGFSSTSVLPHTGYIYHSDIVQSLPPDLRRKAARLVAAKCTLAARVDSFHESTEGKVGYELKDEIERKFDKWQ 332
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhh.hhhhhhhhhhhhh........hhhhhh..hhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhh..hhhhhhhhhhhhh.hhhhhh.hhhhhh.........------......hhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------E---------------------P-------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------NOP  PDB: K:215-332 UniProt: 215-333                                                                                   PROSITE
           Transcript 1 (1) Exon 1.5  PDB: K:86-108--------------------------------Exon 1.7  PDB: K:141-176            --------------------------------------------------------Exon 1.9d  PDB: K:233-285 (gaps) UniProt: 233-285    Exon 1.10b  PDB: K:286-315    Exon 1.11c        Transcript 1 (1)
           Transcript 1 (2) ----------------------Exon 1.6  PDB: K:108-140         -----------------------------------Exon 1.8  PDB: K:176-233 UniProt: 176-233                 --------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3siv K  86 AAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGNSLDKCKNNENLQQILTNATIMVVSVTASTTQGQQLSEEELERLEEACDMALELNASKHRIYEYVESRMSFIAPNLSIIIGASTAAKIMGVAGGLTNLSKMPACNIMLLGAQRKTL------SVLPHTGYIYHSDIVQSLPPDLRRKAARLVAAKCTLAARVDSFHESTEGKVGYELKDEIERKFDKWQ 332
                                    95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255   |     -|      275       285       295       305       315       325       
                                                                                                                                                                                                       259    266

Chain L from PDB  Type:RNA  Length:32
                                                                
                 3siv L  26 UACUGUCCAAUGAGCGCAUAGUGAGGGCAGUA  57
                                    35        45        55

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit(hide GO term definitions)

Chain A,D,G,J (NH2L1_HUMAN | P55769)

molecular function
	GO:0051117	ATPase binding	Interacting selectively and non-covalently with an ATPase, any enzyme that catalyzes the hydrolysis of ATP.
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0034511	U3 snoRNA binding	Interacting selectively and non-covalently with U3 small nucleolar RNA.
	GO:0030621	U4 snRNA binding	Interacting selectively and non-covalently with the U4 small nuclear RNA (U4 snRNA).
	GO:0030622	U4atac snRNA binding	Interacting selectively and non-covalently with the U4atac small nuclear RNA (U4atac snRNA).
	GO:0034512	box C/D snoRNA binding	Interacting selectively and non-covalently with box C/D small nucleolar RNA.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0030515	snoRNA binding	Interacting selectively and non-covalently with small nucleolar RNA.
biological process
	GO:0008380	RNA splicing	The process of removing sections of the primary RNA transcript to remove sequences not present in the mature form of the RNA and joining the remaining sections to form the mature form of the RNA.
	GO:0006397	mRNA processing	Any process involved in the conversion of a primary mRNA transcript into one or more mature mRNA(s) prior to translation into polypeptide.
	GO:0000398	mRNA splicing, via spliceosome	The joining together of exons from one or more primary transcripts of messenger RNA (mRNA) and the excision of intron sequences, via a spliceosomal mechanism, so that mRNA consisting only of the joined exons is produced.
	GO:0000470	maturation of LSU-rRNA	Any process involved in the maturation of a precursor Large SubUnit (LSU) ribosomal RNA (rRNA) molecule into a mature LSU-rRNA molecule.
	GO:0030490	maturation of SSU-rRNA	Any process involved in the maturation of a precursor Small SubUnit (SSU) ribosomal RNA (rRNA) molecule into a mature SSU-rRNA molecule.
	GO:0006364	rRNA processing	Any process involved in the conversion of a primary ribosomal RNA (rRNA) transcript into one or more mature rRNA molecules.
	GO:0042254	ribosome biogenesis	A cellular process that results in the biosynthesis of constituent macromolecules, assembly, and arrangement of constituent parts of ribosome subunits; includes transport to the sites of protein synthesis.
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
cellular component
	GO:0046540	U4/U6 x U5 tri-snRNP complex	A ribonucleoprotein complex formed by the association of the U4/U6 and U5 small nuclear ribonucleoproteins.
	GO:0031428	box C/D snoRNP complex	A ribonucleoprotein complex containing small nucleolar RNA of the box C/D type that can carry out ribose-2'-O-methylation of target RNAs.
	GO:0022625	cytosolic large ribosomal subunit	The large subunit of a ribosome located in the cytosol.
	GO:0001651	dense fibrillar component	A structure found in the nucleolus, which contains newly synthesized preribosomal RNA (pre-rRNA) and a collection of proteins.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0005730	nucleolus	A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0071011	precatalytic spliceosome	A spliceosomal complex that is formed by the recruitment of a preassembled U5-containing tri-snRNP to the prespliceosome. Although all 5 snRNPs are present, the precatalytic spliceosome is catalytically inactive. The precatalytic spliceosome includes many proteins in addition to those found in the associated snRNPs.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
	GO:0032040	small-subunit processome	A large ribonucleoprotein complex that is an early preribosomal complex. In S. cerevisiae, it has a size of 80S and consists of the 35S pre-rRNA, early-associating ribosomal proteins most of which are part of the small ribosomal subunit, the U3 snoRNA and associated proteins.
	GO:0005681	spliceosomal complex	Any of a series of ribonucleoprotein complexes that contain snRNA(s) and small nuclear ribonucleoproteins (snRNPs), and are formed sequentially during the spliceosomal splicing of one or more substrate RNAs, and which also contain the RNA substrate(s) from the initial target RNAs of splicing, the splicing intermediate RNA(s), to the final RNA products. During cis-splicing, the initial target RNA is a single, contiguous RNA transcript, whether mRNA, snoRNA, etc., and the released products are a spliced RNA and an excised intron, generally as a lariat structure. During trans-splicing, there are two initial substrate RNAs, the spliced leader RNA and a pre-mRNA.

Chain B,E,H,K (PRP31_HUMAN | Q8WWY3)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0030621	U4 snRNA binding	Interacting selectively and non-covalently with the U4 small nuclear RNA (U4 snRNA).
	GO:0030622	U4atac snRNA binding	Interacting selectively and non-covalently with the U4atac small nuclear RNA (U4atac snRNA).
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0043021	ribonucleoprotein complex binding	Interacting selectively and non-covalently with any complex of RNA and protein.
	GO:0070990	snRNP binding	Interacting selectively and non-covalently with any part of a small nuclear ribonucleoprotein particle.
biological process
	GO:0008380	RNA splicing	The process of removing sections of the primary RNA transcript to remove sequences not present in the mature form of the RNA and joining the remaining sections to form the mature form of the RNA.
	GO:0006397	mRNA processing	Any process involved in the conversion of a primary mRNA transcript into one or more mature mRNA(s) prior to translation into polypeptide.
	GO:0000398	mRNA splicing, via spliceosome	The joining together of exons from one or more primary transcripts of messenger RNA (mRNA) and the excision of intron sequences, via a spliceosomal mechanism, so that mRNA consisting only of the joined exons is produced.
	GO:0071166	ribonucleoprotein complex localization	Any process in which a ribonucleoprotein complex is transported to, or maintained in, a specific location within a cell.
	GO:0048254	snoRNA localization	Any process in which small nucleolar RNA is transported to, or maintained in, a specific location.
	GO:0000244	spliceosomal tri-snRNP complex assembly	The formation of a tri-snRNP complex containing U4 and U6 (or U4atac and U6atac) snRNAs and U5 snRNAs and associated proteins. This includes reannealing of U4 and U6 (or U4atac and U6atac) snRNAs released from previous rounds of splicing to reform the U4/U6 snRNP (or U4atac/U6atac snRNP) as well as the subsequent association of the U5 snRNP with the U4/U6 snRNP (or U4atac/U6atac snRNP) to form a tri-snRNP that is ready to reassemble into another spliceosome complex.
cellular component
	GO:0015030	Cajal body	A class of nuclear body, first seen after silver staining by Ramon y Cajal in 1903, enriched in small nuclear ribonucleoproteins, and certain general RNA polymerase II transcription factors; ultrastructurally, they appear as a tangle of coiled, electron-dense threads roughly 0.5 micrometers in diameter; involved in aspects of snRNP biogenesis; the protein coilin serves as a marker for Cajal bodies. Some argue that Cajal bodies are the sites for preassembly of transcriptosomes, unitary particles involved in transcription and processing of RNA.
	GO:0071339	MLL1 complex	A protein complex that can methylate lysine-4 of histone H3. MLL1/MLL is the catalytic methyltransferase subunit, and the complex also contains the core components ASH2L, HCFC1/HCF1 WDR5 and RBBP5.
	GO:0005684	U2-type spliceosomal complex	Any spliceosomal complex that forms during the splicing of a messenger RNA primary transcript to excise an intron that has canonical consensus sequences near the 5' and 3' ends.
	GO:0005687	U4 snRNP	A ribonucleoprotein complex that contains small nuclear RNA U4.
	GO:0046540	U4/U6 x U5 tri-snRNP complex	A ribonucleoprotein complex formed by the association of the U4/U6 and U5 small nuclear ribonucleoproteins.
	GO:0005690	U4atac snRNP	A ribonucleoprotein complex that contains small nuclear RNA U4atac.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0016607	nuclear speck	A discrete extra-nucleolar subnuclear domain, 20-50 in number, in which splicing factors are seen to be localized by immunofluorescence microscopy.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0071011	precatalytic spliceosome	A spliceosomal complex that is formed by the recruitment of a preassembled U5-containing tri-snRNP to the prespliceosome. Although all 5 snRNPs are present, the precatalytic spliceosome is catalytically inactive. The precatalytic spliceosome includes many proteins in addition to those found in the associated snRNPs.
	GO:0005681	spliceosomal complex	Any of a series of ribonucleoprotein complexes that contain snRNA(s) and small nuclear ribonucleoproteins (snRNPs), and are formed sequentially during the spliceosomal splicing of one or more substrate RNAs, and which also contain the RNA substrate(s) from the initial target RNAs of splicing, the splicing intermediate RNA(s), to the final RNA products. During cis-splicing, the initial target RNA is a single, contiguous RNA transcript, whether mRNA, snoRNA, etc., and the released products are a spliced RNA and an excised intron, generally as a lariat structure. During trans-splicing, there are two initial substrate RNAs, the spliced leader RNA and a pre-mRNA.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (8, 8)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (3, 12)

PROSITE Motifs (2, 8)

Exons (10, 38)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (39, 52)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File