3SIP - JenaLib

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:149
 aligned with DRICE_DROME | O01382 from UniProtKB/Swiss-Prot  Length:339

    Alignment length:194
                                    38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218    
          DRICE_DROME    29 ALGSVGSGGAGSSGLVAGSSHPYGSGAIGQLANGYSSPSSSYRKNVAKMVTDRHAAEYNMRHKNRGMALIFNHEHFEVPTLKSRAGTNVDCENLTRVLKQLDFEVTVYKDCRYKDILRTIEYAASQNHSDSDCILVAILSHGEMGYIYAKDTQYKLDNIWSFFTANHCPSLAGKPKLFFIQACQGDRLDGGVTM 222
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee..---------------------------------------------.............eeeeeeeee.............hhhhhhhhhhhhhhhh..eeeee...hhhhhhhhhhhhhh.hhh.eeeeeeeeee......ee....ee.hhhhhhhhhhhhhhhhh...eeeeeee.........ee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------CASPASE_P20  PDB: A:19-142 UniProt: 92-215                                                                                  ------- PROSITE (3)
                PROSITE (1) -------------------------------------------------------------------------------------------------------------------------------CASPASE_HIS    -------------------------------CASPASE_CYS --------- PROSITE (1)
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3sip A   1 ALGSV---------------------------------------------TDRHAAEYNMRHKNRGMALIFNHEHFEVPTLKSRAGTNVDCENLTRVLKQLDFEVTVYKDCRYKDILRTIEYAASQNHSDSDCILVAILSHGEMGYIYAKDTQYKLDNIWSFFTANHCPSLAGKPKLFFIQACQGDRLDGGVTM 149
                                |    -         -         -         -         -|       15        25        35        45        55        65        75        85        95       105       115       125       135       145    
                                5                                             6

Chain B from PDB  Type:PROTEIN  Length:103
 aligned with DRICE_DROME | O01382 from UniProtKB/Swiss-Prot  Length:339

    Alignment length:103
                                   244       254       264       274       284       294       304       314       324       334   
          DRICE_DROME   235 MSYKIPVHADFLIAYSTVPGFYSWRNTTRGSWFMQSLCAELAANGKRLDILTLLTFVCQRVAVDFESCTPDTPEMHQQKQIPCITTMLTRILRFSDKQLAPAG 337
               SCOP domains ------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...ee.....eeeee.........ee...eehhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh.......hhhhh......eeee................. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (1) CASPASE_P10  PDB: B:162-257 UniProt: 235-330                                                    ------- PROSITE (1)
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 3sip B 162 MSYKIPVHADFLIAYSTVPGFYSWRNTTRGSWFMQSLCAELAANGKRLDILTLLTFVCQRVAVDFESCTPDTPEMHQQKQIPCITTMLTRILRFSDKQLAPAG 264
                                   171       181       191       201       211       221       231       241       251       261

Chain C from PDB  Type:PROTEIN  Length:152
 aligned with DRICE_DROME | O01382 from UniProtKB/Swiss-Prot  Length:339

    Alignment length:197
                                    38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       
          DRICE_DROME    29 ALGSVGSGGAGSSGLVAGSSHPYGSGAIGQLANGYSSPSSSYRKNVAKMVTDRHAAEYNMRHKNRGMALIFNHEHFEVPTLKSRAGTNVDCENLTRVLKQLDFEVTVYKDCRYKDILRTIEYAASQNHSDSDCILVAILSHGEMGYIYAKDTQYKLDNIWSFFTANHCPSLAGKPKLFFIQACQGDRLDGGVTMQRS 225
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee..---------------------------------------------.............eeeeeeeee.............hhhhhhhhhhhhhhhh..eeeee...hhhhhhhhhhhhhh.hhh.eeeeeeeeee......ee....ee.hhhhhhhhhhhhhhhhh...eeeeeee.........ee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------CASPASE_P20  PDB: C:19-142 UniProt: 92-215                                                                                  ---------- PROSITE (3)
                PROSITE (1) -------------------------------------------------------------------------------------------------------------------------------CASPASE_HIS    -------------------------------CASPASE_CYS ------------ PROSITE (1)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3sip C   1 ALGSV---------------------------------------------TDRHAAEYNMRHKNRGMALIFNHEHFEVPTLKSRAGTNVDCENLTRVLKQLDFEVTVYKDCRYKDILRTIEYAASQNHSDSDCILVAILSHGEMGYIYAKDTQYKLDNIWSFFTANHCPSLAGKPKLFFIQACQGDRLDGGVTMQRS 152
                                |    -         -         -         -         -|       15        25        35        45        55        65        75        85        95       105       115       125       135       145       
                                5                                             6

Chain D from PDB  Type:PROTEIN  Length:100
 aligned with DRICE_DROME | O01382 from UniProtKB/Swiss-Prot  Length:339

    Alignment length:100
                                   246       256       266       276       286       296       306       316       326       336
          DRICE_DROME   237 YKIPVHADFLIAYSTVPGFYSWRNTTRGSWFMQSLCAELAANGKRLDILTLLTFVCQRVAVDFESCTPDTPEMHQQKQIPCITTMLTRILRFSDKQLAPA 336
               SCOP domains ---------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee.....eeeee.........ee...eehhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh.......hhhhh......eeee................ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (1) CASPASE_P10  PDB: - UniProt: 235-330                                                          ------ PROSITE (1)
                 Transcript ---------------------------------------------------------------------------------------------------- Transcript
                 3sip D 164 YKIPVHADFLIAYSTVPGFYSWRNTTRGSWFMQSLCAELAANGKRLDILTLLTFVCQRVAVDFESCTPDTPEMHQQKQIPCITTMLTRILRFSDKQLAPA 263
                                   173       183       193       203       213       223       233       243       253       263

Chain E from PDB  Type:PROTEIN  Length:100
 aligned with DIAP1_DROME | Q24306 from UniProtKB/Swiss-Prot  Length:438

    Alignment length:100
                                    49        59        69        79        89        99       109       119       129       139
          DIAP1_DROME    40 DLNREETRLKTFTDWPLDWLDKRQLAQTGMYFTHAGDKVKCFFCGVEIGCWEQEDQPVPEHQRWSPNCPLLRRRTTNNVPINAEALDRILPPISYDICGA 139
               SCOP domains ---------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhh.......hhhhhhhh.eee......eee.....eee......hhhhhhhhhh................hhhhhhhhh.....ee... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----BIR_REPEAT_1  PDB: E:44-110 UniProt: 44-110                        ----------------------------- PROSITE (1)
                PROSITE (2) -------BIR_REPEAT_2  PDB: E:47-111 UniProt: 47-111                      ---------------------------- PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------- Transcript
                 3sip E  40 DLNREETRLKTFTDWPLDWLDKRQLAQTGMYFTHAGDKVKCFFCGVEIGSWEQEDQPVPEHQRWSPNCPLLRRRTTNNVPINAEALDRILPPISYDICGA 139
                                    49        59        69        79        89        99       109       119       129       139

Chain F from PDB  Type:PROTEIN  Length:108
 aligned with DIAP1_DROME | Q24306 from UniProtKB/Swiss-Prot  Length:438

    Alignment length:108
                                    47        57        67        77        87        97       107       117       127       137        
          DIAP1_DROME    38 MNDLNREETRLKTFTDWPLDWLDKRQLAQTGMYFTHAGDKVKCFFCGVEIGCWEQEDQPVPEHQRWSPNCPLLRRRTTNNVPINAEALDRILPPISYDICGANDSTLE 145
               SCOP domains ------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....hhhhhhhhhh.......hhhhhhhh.eee......eee.....eee......hhhhhhhhhh................hhhhhhhhh.....ee......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ------BIR_REPEAT_1  PDB: F:44-110 UniProt: 44-110                        ----------------------------------- PROSITE (1)
                PROSITE (2) ---------BIR_REPEAT_2  PDB: F:47-111 UniProt: 47-111                      ---------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------ Transcript
                 3sip F  38 MNDLNREETRLKTFTDWPLDWLDKRQLAQTGMYFTHAGDKVKCFFCGVEIGSWEQEDQPVPEHQRWSPNCPLLRRRTTNNVPINAEALDRILPPISYDICGANDSTLE 145
                                    47        57        67        77        87        97       107       117       127       137

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (DRICE_DROME | O01382)

molecular function
	GO:1990525	BIR domain binding	Interacting selectively and non-covalently with a Baculovirus Inhibitor of apoptosis protein Repeat (BIR) domain.
	GO:0004197	cysteine-type endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile.
	GO:0097153	cysteine-type endopeptidase activity involved in apoptotic process	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile, and contributing to the apoptotic process.
	GO:0097200	cysteine-type endopeptidase activity involved in execution phase of apoptosis	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile, and contributing to the execution phase of apoptosis.
	GO:0008234	cysteine-type peptidase activity	Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0008233	peptidase activity	Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006915	apoptotic process	A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
	GO:0097194	execution phase of apoptosis	A stage of the apoptotic process that starts with the controlled breakdown of the cell through the action of effector caspases or other effector molecules (e.g. cathepsins, calpains etc.). Key steps of the execution phase are rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
	GO:0016322	neuron remodeling	The developmentally regulated remodeling of neuronal projections such as pruning to eliminate the extra dendrites and axons projections set up in early stages of nervous system development.
	GO:0045476	nurse cell apoptotic process	Any apoptotic process in a nurse cell. During late oogenesis, following the transfer of substances from the nurse cells to the oocyte, nurse cell remnants are cleared from the egg chamber by apoptotic process.
	GO:0046672	positive regulation of compound eye retinal cell programmed cell death	Any process that activates or increases the frequency, rate or extent of programmed cell death that occurs in the compound eye retina.
	GO:2001269	positive regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway	Any process that activates or increases the frequency, rate or extent of cysteine-type endopeptidase activity involved in apoptotic signaling pathway.
	GO:0012501	programmed cell death	A process which begins when a cell receives an internal or external signal and activates a series of biochemical events (signaling pathway). The process ends with the death of the cell.
	GO:0010623	programmed cell death involved in cell development	The activation of endogenous cellular processes that result in the death of a cell as part of its development.
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
	GO:0046668	regulation of retinal cell programmed cell death	Any process that modulates the frequency, rate or extent of programmed cell death that occurs in the retina.
	GO:0010165	response to X-ray	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of X-ray radiation. An X-ray is a form of electromagnetic radiation with a wavelength in the range of 10 nanometers to 100 picometers (corresponding to frequencies in the range 30 PHz to 3 EHz).
	GO:0035070	salivary gland histolysis	The stage-specific break down of the larval salivary glands during Drosophila metamorphosis, to allow replacement of larval structures by tissues and structures that form the adult fly.
	GO:0048515	spermatid differentiation	The process whose specific outcome is the progression of a spermatid over time, from initial commitment of the cell to a specific fate, to the fully functional differentiated cell.
	GO:0035103	sterol regulatory element binding protein cleavage	The proteolytic release of a transcriptionally active sterol regulatory element binding protein (SREBP) from intracellular membranes, freeing it to move to the nucleus to upregulate transcription of target genes, in response to altered levels of one or more lipids.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Chain E,F (DIAP1_DROME | Q24306)

molecular function
	GO:0061663	NEDD8 ligase activity	Catalysis of the transfer of NEDD8 to a substrate protein via the reaction X-NEDD8 + S --> X + S-NEDD8, where X is either an E2 or E3 enzyme, the X-NEDD8 linkage is a thioester bond, and the S-NEDD8 linkage is an isopeptide bond between the C-terminal amino acid of NEDD8 and the epsilon-amino group of lysine residues in the substrate.
	GO:0089720	caspase binding	Interacting selectively and non-covalently with a caspase family protein.
	GO:0004869	cysteine-type endopeptidase inhibitor activity	Stops, prevents or reduces the activity of a cysteine-type endopeptidase, any enzyme that hydrolyzes peptide bonds in polypeptides by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile.
	GO:0043027	cysteine-type endopeptidase inhibitor activity involved in apoptotic process	Stops, prevents or reduces the activity of a cysteine-type endopeptidase involved in the apoptotic process.
	GO:0016874	ligase activity	Catalysis of the joining of two substances, or two groups within a single molecule, with the concomitant hydrolysis of the diphosphate bond in ATP or a similar triphosphate.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0031624	ubiquitin conjugating enzyme binding	Interacting selectively and non-covalently with a ubiquitin conjugating enzyme, any of the E2 proteins.
	GO:0061630	ubiquitin protein ligase activity	Catalysis of the transfer of ubiquitin to a substrate protein via the reaction X-ubiquitin + S -> X + S-ubiquitin, where X is either an E2 or E3 enzyme, the X-ubiquitin linkage is a thioester bond, and the S-ubiquitin linkage is an amide bond: an isopeptide bond between the C-terminal glycine of ubiquitin and the epsilon-amino group of lysine residues in the substrate or, in the linear extension of ubiquitin chains, a peptide bond the between the C-terminal glycine and N-terminal methionine of ubiquitin residues.
	GO:0031625	ubiquitin protein ligase binding	Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
	GO:0044390	ubiquitin-like protein conjugating enzyme binding	Interacting selectively and non-covalently with a ubiquitin-like protein conjugating enzyme such as ubiquitin conjugating enzyme.
	GO:0004842	ubiquitin-protein transferase activity	Catalysis of the transfer of ubiquitin from one protein to another via the reaction X-Ub + Y --> Y-Ub + X, where both X-Ub and Y-Ub are covalent linkages.
	GO:1990381	ubiquitin-specific protease binding	Interacting selectively and non-covalently with a ubiquitin-specific protease.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0016055	Wnt signaling pathway	The series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell and ending with a change in cell state.
	GO:0048800	antennal morphogenesis	The process in which the anatomical structures of the antenna are generated and organized.
	GO:0006915	apoptotic process	A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
	GO:0007298	border follicle cell migration	The directed movement of a border cell through the nurse cells to reach the oocyte. An example of this is found in Drosophila melanogaster.
	GO:0008407	chaeta morphogenesis	The process in which the anatomical structures of the chaeta are generated and organized. A chaeta is a sensory multicellular cuticular outgrowth of a specifically differentiated cell.
	GO:0008354	germ cell migration	The orderly movement of a cell specialized to produce haploid gametes through the embryo from its site of production to the place where the gonads will form.
	GO:0097340	inhibition of cysteine-type endopeptidase activity	Any process that prevents the activation of an inactive cysteine-type endopeptidase.
	GO:1990001	inhibition of cysteine-type endopeptidase activity involved in apoptotic process	Any process that prevents the activation of an inactive cysteine-type endopeptidase involved in an apoptotic process.
	GO:0090307	mitotic spindle assembly	The aggregation, arrangement and bonding together of a set of components to form the spindle that contributes to the process of mitosis.
	GO:0007275	multicellular organism development	The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
	GO:0043066	negative regulation of apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
	GO:0046673	negative regulation of compound eye retinal cell programmed cell death	Any process that stops, prevents, or reduces the frequency, rate or extent of programmed cell death that occurs in the compound eye retina.
	GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of a cysteine-type endopeptidase activity involved in the apoptotic process.
	GO:2001271	negative regulation of cysteine-type endopeptidase activity involved in execution phase of apoptosis	Any process that stops, prevents or reduces the frequency, rate or extent of cysteine-type endopeptidase activity involved in execution phase of apoptosis.
	GO:0090263	positive regulation of canonical Wnt signaling pathway	Any process that increases the rate, frequency, or extent of the Wnt signaling pathway through beta-catenin, the series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell, followed by propagation of the signal via beta-catenin, and ending with a change in transcription of target genes.
	GO:0031398	positive regulation of protein ubiquitination	Any process that activates or increases the frequency, rate or extent of the addition of ubiquitin groups to a protein.
	GO:0070936	protein K48-linked ubiquitination	A protein ubiquitination process in which a polymer of ubiquitin, formed by linkages between lysine residues at position 48 of the ubiquitin monomers, is added to a protein. K48-linked ubiquitination targets the substrate protein for degradation.
	GO:0051865	protein autoubiquitination	The ubiquitination by a protein of one or more of its own amino acid residues, or residues on an identical protein. Ubiquitination occurs on the lysine residue by formation of an isopeptide crosslink.
	GO:0045116	protein neddylation	Covalent attachment of the ubiquitin-like protein NEDD8 (RUB1) to another protein.
	GO:0000209	protein polyubiquitination	Addition of multiple ubiquitin groups to a protein, forming a ubiquitin chain.
	GO:0042787	protein ubiquitination involved in ubiquitin-dependent protein catabolic process	The process in which a ubiquitin group, or multiple groups, are covalently attached to the target protein, thereby initiating the degradation of that protein.
	GO:0007423	sensory organ development	The process whose specific outcome is the progression of sensory organs over time, from its formation to the mature structure.
	GO:0045035	sensory organ precursor cell division	The series of four asymmetric divisions undergone by the sensory organ precursor cells to generate cells that have distinct cell fates. For example, in the external sensory organ, the precursor cells give rise to one multidendritic neuron and four additional cells (the socket, shaft, sheath cells and the external sense neuron).
	GO:0007289	spermatid nucleus differentiation	The specialization of the spermatid nucleus during the development of a spermatid into a mature male gamete competent for fertilization.
	GO:0007283	spermatogenesis	The process of formation of spermatozoa, including spermatocytogenesis and spermiogenesis.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005876	spindle microtubule	Any microtubule that is part of a mitotic or meiotic spindle; anchored at one spindle pole.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (6, 11)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (62, 65)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File