|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 7)| Asymmetric Unit (3, 7) Biological Unit 1 (2, 10) |
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3S6F) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3S6F) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3S6F) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3S6F) |
Exons (0, 0)| (no "Exon" information available for 3S6F) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:143 aligned with Q9RTS8_DEIRA | Q9RTS8 from UniProtKB/TrEMBL Length:144 Alignment length:143 10 20 30 40 50 60 70 80 90 100 110 120 130 140 Q9RTS8_DEIRA 1 MTQRSLADIQFQTTLEGVTPAQLGGFFEGWPNPPTPETLWRILDRAAVFVLARTPDGQVIGFVNALSDGILAASIPLLEVQAGWRSLGLGSELMRRVLTELGDLYMVDLSCDDDVVPFYERLGLKRANAMFLRRYDNQAGIPA 143 SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------Acetyltransf_7-3s6fA01 A:39-126 ----------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript 3s6f A 1 mTQRSLADIQFQTTLEGVTPAQLGGFFEGWPNPPTPETLWRILDRAAVFVLARTPDGQVIGFVNALSDGILAASIPLLEVQAGWRSLGLGSELmRRVLTELGDLYmVDLSCDDDVVPFYERLGLKRANAmFLRRYDNQAGIPA 143 | 10 20 30 40 50 60 70 80 90 | 100 | 110 120 130 140 | 94-MSE 106-MSE 130-MSE 1-MSE
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3S6F) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3S6F) |
Pfam Domains (1, 1)| Asymmetric Unit |
Gene Ontology (1, 1)|
Asymmetric Unit(hide GO term definitions) Chain A (Q9RTS8_DEIRA | Q9RTS8)
|
||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|