3S5F - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF HUMAN FRATAXIN VARIANT W155F

Authors :   C. -L. Tsai, J. Bridwell-Rabb, D. P. Barondeau

Date :   23 May 11 (Deposition) - 29 Jun 11 (Release) - 03 Aug 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.50

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Allosteric Activator, Mitochondrion, Alpha Beta 2-Layer Sandwich, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   C. L. Tsai, J. Bridwell-Rabb, D. P. Barondeau
Friedreich'S Ataxia Variants I154F And W155R Diminish Frataxin-Based Activation Of The Iron-Sulfur Cluster Assembly Complex.
Biochemistry V. 50 6478 2011
PubMed-ID: 21671584 | Reference-DOI: 10.1021/BI200666H

Molecule 1 - FRATAXIN, MITOCHONDRIAL
	Chains	:	A, B
	EC Number	:	1.16.3.1
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET11A
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Fragment	:	MATURE FORM (UNP RESIDUES 82-210)
	Gene	:	FRDA, FXN, X25
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	FRIEDREICH ATAXIA PROTEIN, FXN

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 2)

No.	Name	Count	Type	Full Name
1	MG	2	Ligand/Ion	MAGNESIUM ION

Biological Unit 1 (0, 0)

No.	Name	Count	Type	Full Name
1	MG	-1	Ligand/Ion	MAGNESIUM ION

Biological Unit 2 (0, 0)

No.	Name	Count	Type	Full Name
1	MG	-1	Ligand/Ion	MAGNESIUM ION

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ALA A:114 , LYS A:116 , THR A:119 , HOH A:1098	BINDING SITE FOR RESIDUE MG A 1034
2	AC2	SOFTWARE	ALA B:114 , LYS B:116 , THR B:119 , HOH B:1071 , HOH B:1095	BINDING SITE FOR RESIDUE MG B 1132

(no "SS Bond" information available for 3S5F)

(no "Cis Peptide Bond" information available for 3S5F)

Asymmetric Unit (9, 18)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_016065	L	106	S	FRDA_HUMAN	Disease (FRDA)	104894105	A/B	L	106	S
2	UniProt	VAR_002428	D	122	Y	FRDA_HUMAN	Disease (FRDA)	142157346	A/B	D	122	Y
3	UniProt	VAR_002429	G	130	V	FRDA_HUMAN	Disease (FRDA)	104894107	A/B	G	130	V
4	UniProt	VAR_002430	I	154	F	FRDA_HUMAN	Disease (FRDA)	104894106	A/B	I	154	F
5	UniProt	VAR_002431	W	155	R	FRDA_HUMAN	Disease (FRDA)	138471431	A/B	F	155	R
6	UniProt	VAR_008139	R	165	C	FRDA_HUMAN	Disease (FRDA)	138034837	A/B	R	165	C
7	UniProt	VAR_008140	L	182	F	FRDA_HUMAN	Disease (FRDA)	139616452	A/B	L	182	F
8	UniProt	VAR_016066	L	198	R	FRDA_HUMAN	Disease (FRDA)	144104124	A/B	L	198	R
9	UniProt	VAR_049100	S	202	C	FRDA_HUMAN	Polymorphism	1052195	A/B	S	202	C

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (9, 9)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_016065	L	106	S	FRDA_HUMAN	Disease (FRDA)	104894105	A	L	106	S
2	UniProt	VAR_002428	D	122	Y	FRDA_HUMAN	Disease (FRDA)	142157346	A	D	122	Y
3	UniProt	VAR_002429	G	130	V	FRDA_HUMAN	Disease (FRDA)	104894107	A	G	130	V
4	UniProt	VAR_002430	I	154	F	FRDA_HUMAN	Disease (FRDA)	104894106	A	I	154	F
5	UniProt	VAR_002431	W	155	R	FRDA_HUMAN	Disease (FRDA)	138471431	A	F	155	R
6	UniProt	VAR_008139	R	165	C	FRDA_HUMAN	Disease (FRDA)	138034837	A	R	165	C
7	UniProt	VAR_008140	L	182	F	FRDA_HUMAN	Disease (FRDA)	139616452	A	L	182	F
8	UniProt	VAR_016066	L	198	R	FRDA_HUMAN	Disease (FRDA)	144104124	A	L	198	R
9	UniProt	VAR_049100	S	202	C	FRDA_HUMAN	Polymorphism	1052195	A	S	202	C

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (9, 9)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_016065	L	106	S	FRDA_HUMAN	Disease (FRDA)	104894105	B	L	106	S
2	UniProt	VAR_002428	D	122	Y	FRDA_HUMAN	Disease (FRDA)	142157346	B	D	122	Y
3	UniProt	VAR_002429	G	130	V	FRDA_HUMAN	Disease (FRDA)	104894107	B	G	130	V
4	UniProt	VAR_002430	I	154	F	FRDA_HUMAN	Disease (FRDA)	104894106	B	I	154	F
5	UniProt	VAR_002431	W	155	R	FRDA_HUMAN	Disease (FRDA)	138471431	B	F	155	R
6	UniProt	VAR_008139	R	165	C	FRDA_HUMAN	Disease (FRDA)	138034837	B	R	165	C
7	UniProt	VAR_008140	L	182	F	FRDA_HUMAN	Disease (FRDA)	139616452	B	L	182	F
8	UniProt	VAR_016066	L	198	R	FRDA_HUMAN	Disease (FRDA)	144104124	B	L	198	R
9	UniProt	VAR_049100	S	202	C	FRDA_HUMAN	Polymorphism	1052195	B	S	202	C

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FRATAXIN_2	PS50810	Frataxin family profile.	FRDA_HUMAN	90-198	2	A:90-198 B:90-198
2	FRATAXIN_1	PS01344	Frataxin family signature.	FRDA_HUMAN	144-158	2	A:144-158 B:144-158

Biological Unit 1 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FRATAXIN_2	PS50810	Frataxin family profile.	FRDA_HUMAN	90-198	1	A:90-198 -
2	FRATAXIN_1	PS01344	Frataxin family signature.	FRDA_HUMAN	144-158	1	A:144-158 -

Biological Unit 2 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FRATAXIN_2	PS50810	Frataxin family profile.	FRDA_HUMAN	90-198	1	- B:90-198
2	FRATAXIN_1	PS01344	Frataxin family signature.	FRDA_HUMAN	144-158	1	- B:144-158

Asymmetric Unit (4, 7)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000377270	1a	ENSE00001944433	chr9:71650175-71650863	689	FRDA_HUMAN	1-55	55	0	-	-
1.3a	ENST00000377270	3a	ENSE00001089855	chr9:71661301-71661398	98	FRDA_HUMAN	56-88	33	1	- B:85-88	- 4
1.4	ENST00000377270	4	ENSE00001089856	chr9:71668056-71668176	121	FRDA_HUMAN	88-128	41	2	A:89-128 B:88-128	40 41
1.5a	ENST00000377270	5a	ENSE00001089858	chr9:71679854-71679951	98	FRDA_HUMAN	129-161	33	2	A:129-161 B:129-161	33 33
1.6d	ENST00000377270	6d	ENSE00001865767	chr9:71687528-71689129	1602	FRDA_HUMAN	161-210	50	2	A:161-208 B:161-209	48 49

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:120
 aligned with FRDA_HUMAN | Q16595 from UniProtKB/Swiss-Prot  Length:210

    Alignment length:120
                                    98       108       118       128       138       148       158       168       178       188       198       208
           FRDA_HUMAN    89 SLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGK 208
               SCOP domains d3s5fa_ A: automated matches                                                                                             SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhh.........eeeee..eeeee......eeeeeee....eeeeee...eeeeeee....ee......hhhhhhhhhhhhhhh............. Sec.struct. author
                 SAPs(SNPs) -----------------S---------------Y-------V-----------------------FR---------C----------------F---------------R---C------ SAPs(SNPs)
                PROSITE (1) -FRATAXIN_2  PDB: A:90-198 UniProt: 90-198                                                                    ---------- PROSITE (1)
                PROSITE (2) -------------------------------------------------------FRATAXIN_1     -------------------------------------------------- PROSITE (2)
           Transcript 1 (1) ----------------------------------------Exon 1.5a  PDB: A:129-161        ----------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) Exon 1.4  PDB: A:89-128 UniProt: 88-128 --------------------------------Exon 1.6d  PDB: A:161-208 UniProt: 161-210       Transcript 1 (2)
                 3s5f A  89 SLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIFLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGK 208
                                    98       108       118       128       138       148       158       168       178       188       198       208

Chain B from PDB  Type:PROTEIN  Length:125
 aligned with FRDA_HUMAN | Q16595 from UniProtKB/Swiss-Prot  Length:210

    Alignment length:125
                                    94       104       114       124       134       144       154       164       174       184       194       204     
           FRDA_HUMAN    85 GHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKD 209
               SCOP domains d3s5fb_ B: automated matches                                                                                                  SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -----Frataxin_Cyay-3s5fB01 B:90-201                                                                                  -------- Pfam domains (1)
           Pfam domains (2) -----Frataxin_Cyay-3s5fB02 B:90-201                                                                                  -------- Pfam domains (2)
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......eeeee..eeeee......eeeeeeehhh.eeeeee...eeeeeee....ee......hhhhhhhhhhhhhhh.............. Sec.struct. author
                 SAPs(SNPs) ---------------------S---------------Y-------V-----------------------FR---------C----------------F---------------R---C------- SAPs(SNPs)
                PROSITE (1) -----FRATAXIN_2  PDB: B:90-198 UniProt: 90-198                                                                    ----------- PROSITE (1)
                PROSITE (2) -----------------------------------------------------------FRATAXIN_1     --------------------------------------------------- PROSITE (2)
           Transcript 1 (1) 1.3a----------------------------------------Exon 1.5a  PDB: B:129-161        ------------------------------------------------ Transcript 1 (1)
           Transcript 1 (2) ---Exon 1.4  PDB: B:88-128 UniProt: 88-128  --------------------------------Exon 1.6d  PDB: B:161-209 UniProt: 161-210        Transcript 1 (2)
                 3s5f B  85 GHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIFLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKD 209
                                    94       104       114       124       134       144       154       164       174       184       194       204

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: N domain of copper amine oxidase-like (44)

Superfamily: Frataxin/Nqo15-like (24)

Family: Frataxin-like (19)

Protein domain: automated matches (9)

Human (Homo sapiens) [TaxId: 9606] (9)

1a	d3s5fa_	A:
1b	d3s5fb_	B:

(no "CATH Domain" information available for 3S5F)

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: no clan defined [family: Frataxin_Cyay] (7)

Family: Frataxin_Cyay (7)

Homo sapiens (Human) (5)

1a	Frataxin_Cyay-3s5fB01	B:90-201
1b	Frataxin_Cyay-3s5fB02	B:90-201

Asymmetric Unit(hide GO term definitions)

Chain A,B (FRDA_HUMAN | Q16595)

molecular function
	GO:0051537	2 iron, 2 sulfur cluster binding	Interacting selectively and non-covalently with a 2 iron, 2 sulfur (2Fe-2S) cluster; this cluster consists of two iron atoms, with two inorganic sulfur atoms found between the irons and acting as bridging ligands.
	GO:0008199	ferric iron binding	Interacting selectively and non-covalently with ferric iron, Fe(III).
	GO:0008198	ferrous iron binding	Interacting selectively and non-covalently with ferrous iron, Fe(II).
	GO:0004322	ferroxidase activity	Catalysis of the reaction: 4 Fe2+ + 4 H+ + O2 = 4 Fe3+ + 2 H2O.
	GO:0034986	iron chaperone activity	Assists in the delivery of iron ions to target proteins or compartments.
	GO:0051536	iron-sulfur cluster binding	Interacting selectively and non-covalently with an iron-sulfur cluster, a combination of iron and sulfur atoms.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0007628	adult walking behavior	The behavior of an adult relating to the progression of that organism along the ground by the process of lifting and setting down each leg.
	GO:0009060	aerobic respiration	The enzymatic release of energy from inorganic and organic compounds (especially carbohydrates and fats) which requires oxygen as the terminal electron acceptor.
	GO:0006879	cellular iron ion homeostasis	Any process involved in the maintenance of an internal steady state of iron ions at the level of a cell.
	GO:0070301	cellular response to hydrogen peroxide	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a hydrogen peroxide (H2O2) stimulus.
	GO:0009792	embryo development ending in birth or egg hatching	The process whose specific outcome is the progression of an embryo over time, from zygote formation until the end of the embryonic life stage. The end of the embryonic life stage is organism-specific and may be somewhat arbitrary; for mammals it is usually considered to be birth, for insects the hatching of the first instar larva from the eggshell.
	GO:0006783	heme biosynthetic process	The chemical reactions and pathways resulting in the formation of heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring, from less complex precursors.
	GO:0006811	ion transport	The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0018283	iron incorporation into metallo-sulfur cluster	The incorporation of iron into a metallo-sulfur cluster.
	GO:0055072	iron ion homeostasis	Any process involved in the maintenance of an internal steady state of iron ions within an organism or cell.
	GO:0016226	iron-sulfur cluster assembly	The incorporation of iron and exogenous sulfur into a metallo-sulfur cluster.
	GO:0007005	mitochondrion organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a mitochondrion; includes mitochondrial morphogenesis and distribution, and replication of the mitochondrial genome as well as synthesis of new mitochondrial components.
	GO:0043066	negative regulation of apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
	GO:0040015	negative regulation of multicellular organism growth	Any process that stops, prevents, or reduces the frequency, rate or extent of growth of an organism to reach its usual body size.
	GO:0046621	negative regulation of organ growth	Any process that stops, prevents, or reduces the frequency, rate or extent of growth of an organ of an organism.
	GO:0090201	negative regulation of release of cytochrome c from mitochondria	Any process that decreases the rate, frequency or extent of release of cytochrome c from mitochondria, the process in which cytochrome c is enabled to move from the mitochondrial intermembrane space into the cytosol, which is an early step in apoptosis and leads to caspase activation.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0006119	oxidative phosphorylation	The phosphorylation of ADP to ATP that accompanies the oxidation of a metabolite through the operation of the respiratory chain. Oxidation of compounds establishes a proton gradient across the membrane, providing the energy for ATP synthesis.
	GO:1904234	positive regulation of aconitate hydratase activity	Any process that activates or increases the frequency, rate or extent of aconitate hydratase activity.
	GO:0043085	positive regulation of catalytic activity	Any process that activates or increases the activity of an enzyme.
	GO:0030307	positive regulation of cell growth	Any process that activates or increases the frequency, rate, extent or direction of cell growth.
	GO:0008284	positive regulation of cell proliferation	Any process that activates or increases the rate or extent of cell proliferation.
	GO:0051349	positive regulation of lyase activity	Any process that activates or increases the frequency, rate or extent of lyase activity, the catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond.
	GO:1904231	positive regulation of succinate dehydrogenase activity	Any process that activates or increases the frequency, rate or extent of succinate dehydrogenase activity.
	GO:0019230	proprioception	The series of events by which an organism senses the position, location, orientation, and movement of the body and its parts. Proprioception is mediated by proprioceptors, sensory nerve terminals found in muscles, tendons, and joint capsules, which give information concerning movements and position of the body. The receptors in the labyrinth are sometimes also considered proprioceptors.
	GO:0016540	protein autoprocessing	Processing which a protein carries out itself. This involves actions such as the autolytic removal of residues to generate the mature form of the protein.
	GO:0010722	regulation of ferrochelatase activity	Any process that modulates the frequency, rate or extent of ferrochelatase activity; catalysis of the reaction: protoporphyrin + Fe2+ = protoheme + 2 H+.
	GO:0010039	response to iron ion	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an iron ion stimulus.
	GO:0044281	small molecule metabolic process	The chemical reactions and pathways involving small molecules, any low molecular weight, monomeric, non-encoded molecule.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005759	mitochondrial matrix	The gel-like material, with considerable fine structure, that lies in the matrix space, or lumen, of a mitochondrion. It contains the enzymes of the tricarboxylic acid cycle and, in some organisms, the enzymes concerned with fatty acid oxidation.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		MG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3s5f)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3s5f
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	FRDA_HUMAN \| Q16595
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.16.3.1
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	229300
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	FRDA_HUMAN \| Q16595
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	FRDA_HUMAN \| Q16595	:	1ekg 1ly7 3s4m 3s5d 3s5e 3t3j 3t3k 3t3l 3t3t 3t3x 5kz5

3s4m	CRYSTAL STRUCTURE OF WILD-TYPE HUMAN FRATAXIN
3s5d	CRYSTAL STRUCTURE OF HUMAN FRATAXIN VARIANT W155A
3s5e	CRYSTAL STRUCTURE OF HUMAN FRATAXIN VARIANT W155R, ONE OF THE FRIEDREICH'S ATAXIA POINT MUTATIONS

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (9, 18)

PROSITE Motifs (2, 4)

Exons (4, 7)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (0, 0)

Pfam Domains (1, 2)

Gene Ontology (42, 42)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File