|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 3RY0) |
Sites (0, 0)| (no "Site" information available for 3RY0) |
SS Bonds (0, 0)| (no "SS Bond" information available for 3RY0) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3RY0) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3RY0) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3RY0) |
Exons (0, 0)| (no "Exon" information available for 3RY0) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:65 aligned with C0LTT5_STRAH | C0LTT5 from UniProtKB/TrEMBL Length:66 Alignment length:65 11 21 31 41 51 61 C0LTT5_STRAH 2 PLIRVTLLEGRSPQEVAALGEALTAAAHETLGTPVEAVRVIVEETPPERWFVGGRSVAERRASPS 66 SCOP domains ----------------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------- Transcript 3ry0 A 1 PLIRVTLLEGRSPQEVAALGEALTAAAHETLGTPVEAVRVIVEETPPERWFVGGRSVAERRASPS 65 10 20 30 40 50 60 Chain B from PDB Type:PROTEIN Length:63 aligned with C0LTT5_STRAH | C0LTT5 from UniProtKB/TrEMBL Length:66 Alignment length:63 11 21 31 41 51 61 C0LTT5_STRAH 2 PLIRVTLLEGRSPQEVAALGEALTAAAHETLGTPVEAVRVIVEETPPERWFVGGRSVAERRAS 64 SCOP domains --------------------------------------------------------------- SCOP domains CATH domains --------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------- Transcript 3ry0 B 1 PLIRVTLLEGRSPQEVAALGEALTAAAHETLGTPVEAVRVIVEETPPERWFVGGRSVAERRAS 63 10 20 30 40 50 60
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3RY0) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3RY0) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3RY0) |
Gene Ontology (2, 2)|
Asymmetric Unit(hide GO term definitions) Chain A,B (C0LTT5_STRAH | C0LTT5)
|
||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|