3RW9 - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF HUMAN SPERMIDINE SYNTHASE IN COMPLEX WITH DECARBOXYLATED S-ADENOSYLHOMOCYSTEINE

Authors :   J. Seckute, D. E. Mccloskey, H. J. Thomas, J. A. Secrist Iii, A. E. Pegg, S. E. Ealick

Date :   08 May 11 (Deposition) - 21 Sep 11 (Release) - 02 Nov 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.00

Chains :   Asym./Biol. Unit : A,B

Keywords :   Aminopropyltransferase, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. Seckute, D. E. Mccloskey, H. J. Thomas, J. A. Secrist, A. E. Pegg, S. E. Ealick
Binding And Inhibition Of Human Spermidine Synthase By Decarboxylated S-Adenosylhomocysteine.
Protein Sci. V. 20 1836 2011
PubMed-ID: 21898642 | Reference-DOI: 10.1002/PRO.717

Molecule 1 - SPERMIDINE SYNTHASE
	Chains	:	A, B
	EC Number	:	2.5.1.16
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	MODIFIED PET28A(+)
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	SRM, SPS1, SRML1
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	SPDSY, PUTRESCINE AMINOPROPYLTRANSFERASE

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (1, 2)

No.	Name	Count	Type	Full Name
1	DSH	2	Ligand/Ion	5'-S-(3-AMINOPROPYL)-5'-THIOADENOSINE

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLN A:49 , GLN A:70 , GLN A:80 , GLY A:101 , GLY A:103 , ASP A:104 , CYS A:123 , GLU A:124 , ILE A:125 , VAL A:129 , GLY A:154 , ASP A:155 , GLY A:156 , ASP A:173 , SER A:174 , PRO A:180 , ALA A:181 , SER A:183 , LEU A:184 , HOH A:436	BINDING SITE FOR RESIDUE DSH A 303
2	AC2	SOFTWARE	GLN B:49 , GLN B:70 , GLN B:80 , GLY B:101 , GLY B:103 , ASP B:104 , CYS B:123 , GLU B:124 , ILE B:125 , VAL B:129 , GLY B:154 , ASP B:155 , GLY B:156 , ASP B:173 , SER B:174 , SER B:175 , PRO B:180 , ALA B:181 , SER B:183 , LEU B:184 , HOH B:314 , HOH B:396	BINDING SITE FOR RESIDUE DSH B 303

(no "SS Bond" information available for 3RW9)

(no "Cis Peptide Bond" information available for 3RW9)

Asymmetric/Biological Unit (1, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_011807	L	149	V	SPEE_HUMAN	Polymorphism	1049932	A/B	L	149	V

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PABS_2	PS51006	Polyamine biosynthesis (PABS) domain profile.	SPEE_HUMAN	18-253	2	A:18-253 B:18-253
2	PABS_1	PS01330	Polyamine biosynthesis (PABS) domain signature.	SPEE_HUMAN	97-110	2	A:97-110 B:97-110

Asymmetric/Biological Unit (8, 16)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000376957	1a	ENSE00001836529	chr1:11120081-11119834	248	SPEE_HUMAN	1-56	56	2	A:15-56 B:15-56	42 42
1.2c	ENST00000376957	2c	ENSE00000743131	chr1:11119402-11119282	121	SPEE_HUMAN	56-96	41	2	A:56-96 B:56-96	41 41
1.3a	ENST00000376957	3a	ENSE00000743128	chr1:11118949-11118857	93	SPEE_HUMAN	97-127	31	2	A:97-127 B:97-127	31 31
1.4b	ENST00000376957	4b	ENSE00000743127	chr1:11116814-11116661	154	SPEE_HUMAN	128-179	52	2	A:128-179 (gaps) B:128-179 (gaps)	52 52
1.5	ENST00000376957	5	ENSE00000743125	chr1:11116151-11116068	84	SPEE_HUMAN	179-207	29	2	A:179-207 B:179-207	29 29
1.6b	ENST00000376957	6b	ENSE00000743124	chr1:11115983-11115838	146	SPEE_HUMAN	207-255	49	2	A:207-255 B:207-255	49 49
1.7b	ENST00000376957	7b	ENSE00000743123	chr1:11115141-11115019	123	SPEE_HUMAN	256-296	41	2	A:256-296 B:256-296	41 41
1.7d	ENST00000376957	7d	ENSE00001847545	chr1:11114942-11114646	297	SPEE_HUMAN	297-302	6	2	A:297-300 B:297-299	4 3

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:282
 aligned with SPEE_HUMAN | P19623 from UniProtKB/Swiss-Prot  Length:302

    Alignment length:286
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294      
           SPEE_HUMAN    15 AIREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLPEFARKALND 300
               SCOP domains d3rw9a_ A: automated matches                                                                                                                                                                                                                                                                   SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee..eeee.......eeeeeeeeeeeeeee....eeeeeee....eeeee..eeeee...hhhhhhhhhhhhhh......eeeeee...hhhhhhhh......eeeeee.hhhhhhhhhhhhhhhhhhhhh..eeeee.hhhhhhhh....eeeeeee.----hhhhhhhhhhhhhhhhhheeeeeeeeee......hhhhhhhhhhhhhh...eeeeeeee...hhh.eeeeeeee..............hhhhhhhh.....hhhhhhhh...hhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------V------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---PABS_2  PDB: A:18-253 UniProt: 18-253                                                                                                                                                                                                       ----------------------------------------------- PROSITE (1)
                PROSITE (2) ----------------------------------------------------------------------------------PABS_1        ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.1a  PDB: A:15-56 UniProt: 1-56     ----------------------------------------Exon 1.3a  PDB: A:97-127       Exon 1.4b  PDB: A:128-179 (gaps) UniProt: 128-179   ---------------------------Exon 1.6b  PDB: A:207-255 UniProt: 207-255       Exon 1.7b  PDB: A:256-296                1.7d Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------Exon 1.2c  PDB: A:56-96 UniProt: 56-96   ----------------------------------------------------------------------------------Exon 1.5  PDB: A:179-207     --------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3rw9 A  15 AIREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDS----GPAESLFKESYYQLMKTALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLPEFARKALND 300
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174    |  184       194       204       214       224       234       244       254       264       274       284       294      
                                                                                                                                                                                         174  179

Chain B from PDB  Type:PROTEIN  Length:282
 aligned with SPEE_HUMAN | P19623 from UniProtKB/Swiss-Prot  Length:302

    Alignment length:285
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294     
           SPEE_HUMAN    15 AIREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLPEFARKALN 299
               SCOP domains d3rw9b_ B: automated matches                                                                                                                                                                                                                                                                  SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee..eeee.......eeeeeeeeeeeeeee....eeeeeee....eeeee..eeeee...hhhhhhhhhhhhhh......eeeeee...hhhhhhhh......eeeeee.hhhhhhhhhhhhhhhhhhhhh..eeeee.hhhhhhh.....eeeeeee..---hhhhhhhhhhhhhhhhhheeeeeeeeee......hhhhhhhhhhhhhh...eeeeeeee...hhh.eeeeeeee..............hhhhhhhh.....hhhhhhhh...hhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------V------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ---PABS_2  PDB: B:18-253 UniProt: 18-253                                                                                                                                                                                                       ---------------------------------------------- PROSITE (1)
                PROSITE (2) ----------------------------------------------------------------------------------PABS_1        --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.1a  PDB: B:15-56 UniProt: 1-56     ----------------------------------------Exon 1.3a  PDB: B:97-127       Exon 1.4b  PDB: B:128-179 (gaps) UniProt: 128-179   ---------------------------Exon 1.6b  PDB: B:207-255 UniProt: 207-255       Exon 1.7b  PDB: B:256-296                1.7 Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------Exon 1.2c  PDB: B:56-96 UniProt: 56-96   ----------------------------------------------------------------------------------Exon 1.5  PDB: B:179-207     -------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3rw9 B  15 AIREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSS---GPAESLFKESYYQLMKTALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLPEFARKALN 299
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174|   |  184       194       204       214       224       234       244       254       264       274       284       294     
                                                                                                                                                                                          175 179

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: S-adenosyl-L-methionine-dependent methyltransferases (533)

Superfamily: S-adenosyl-L-methionine-dependent methyltransferases (533)

Family: Spermidine synthase (17)

Protein domain: automated matches (5)

Human (Homo sapiens) [TaxId: 9606] (1)

1a	d3rw9a_	A:
1b	d3rw9b_	B:

(no "CATH Domain" information available for 3RW9)

(no "Pfam Domain" information available for 3RW9)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (SPEE_HUMAN | P19623)

molecular function
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0004766	spermidine synthase activity	Catalysis of the reaction: S-adenosylmethioninamine + putrescine = 5'-methylthioadenosine + spermidine.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0006596	polyamine biosynthetic process	The chemical reactions and pathways resulting in the formation of polyamines, any organic compound containing two or more amino groups.
	GO:0006595	polyamine metabolic process	The chemical reactions and pathways involving polyamines, any organic compound containing two or more amino groups.
	GO:0008295	spermidine biosynthetic process	The chemical reactions and pathways resulting in the formation of spermidine, N-(3-aminopropyl)-1,4-diaminobutane.
cellular component
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		DSH	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3rw9)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3rw9
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	SPEE_HUMAN \| P19623
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.5.1.16
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	SPEE_HUMAN \| P19623
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	SPEE_HUMAN \| P19623	:	2o05 2o06 2o07 2o0l

(no "Related Entries Specified in the PDB File" available for 3RW9)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 2)

PROSITE Motifs (2, 4)

Exons (8, 16)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (9, 9)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File