|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (5, 6)| Asymmetric Unit (5, 6) Biological Unit 1 (4, 10) |
Sites (5, 5)
Asymmetric Unit (5, 5)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3RQI) |
Cis Peptide Bonds (1, 1)
Asymmetric Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3RQI) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3RQI) |
Exons (0, 0)| (no "Exon" information available for 3RQI) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:170 aligned with Q3JXA5_BURP1 | Q3JXA5 from UniProtKB/TrEMBL Length:180 Alignment length:173 12 22 32 42 52 62 72 82 92 102 112 122 132 142 152 162 172 Q3JXA5_BURP1 3 DKNFLVIDDNEVFAGTLARGLERRGYAVRQAHNKDEALKLAGAEKFEFITVDLHLGNDSGLSLIAPLCDLQPDARILVLTGYASIATAVQAVKDGADNYLAKPANVESILAALQTNASEVQAEEALENPVVLSVDRLEWEHIQRVLAENNNNISATARALNMHRRTLQRKLAK 175 SCOP domains d3rqia_ A: automated matches SCOP domains CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ---Response_reg-3rqiA01 A:6-116 ------------------H TH_8-3rqiA02 A:135-175 Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 3rqi A 3 DKNFLVIDDNEVFAGTLARGLERRGYAVRQAHNKDEALKLAGAEKFEFITVdLHLGNDSGLSLIAPLCDLQPDARILVLTGYASIATAVQAVKDGADNYLAKPANVESILAALQTNASEVQAEEALENPVVLS---LEWEHIQRVLAENNNNISATARALNMHRRTLQRKLAK 175 12 22 32 42 52 | 62 72 82 92 102 112 122 132 | |142 152 162 172 54-PHD 135 139
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 3RQI) |
Pfam Domains (2, 2)| Asymmetric Unit |
Gene Ontology (5, 5)|
Asymmetric Unit(hide GO term definitions) Chain A (Q3JXA5_BURP1 | Q3JXA5)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|