Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF ORF6 PROTEIN FROM PHOTOBACTERIUM PROFUNDUM
 
Authors :  M. M. Rodriguez-Guilbe, E. R. Schreiter, A. Baerga Ortiz
Date :  23 Mar 11  (Deposition) - 28 Mar 12  (Release) - 01 May 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.05
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (4x)
Keywords :  Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. Rodriguez-Guilbe, D. Oyola-Robles, E. R. Schreiter, A. Baerga-Ortiz
Structure, Activity, And Substrate Selectivity Of The Orf6 Thioesterase From Photobacterium Profundum.
J. Biol. Chem. V. 288 10841 2013
PubMed-ID: 23430744  |  Reference-DOI: 10.1074/JBC.M112.446765

(-) Compounds

Molecule 1 - PUTATIVE UNCHARACTERIZED PROTEIN
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPGEX 4T-3
    Expression System StrainBL21 RIL
    Expression System Taxid511693
    Expression System Vector TypePLASMID
    Organism ScientificPHOTOBACTERIUM PROFUNDUM
    Organism Taxid74109

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (4x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3R87)

(-) Sites  (0, 0)

(no "Site" information available for 3R87)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3R87)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3R87)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3R87)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3R87)

(-) Exons   (0, 0)

(no "Exon" information available for 3R87)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:132
 aligned with Q93CG9_9GAMM | Q93CG9 from UniProtKB/TrEMBL  Length:133

    Alignment length:132
                                    10        20        30        40        50        60        70        80        90       100       110       120       130  
         Q93CG9_9GAMM     1 MSKIYHHPVQIYYEDTDHSGVVYHPNFLKYFERAREHVIDSDKLATLWNDHGLGFAVYKANMIFQDGVEFAEICDIRTSFTLDGKYKTLWRQEVWRPGASRAAVIGDIEMVCLDKEKRLQPVPADILASMMA 132
               SCOP domains d3r87a_ A: automated matches                                                                                                         SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....eeeeee.hhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeeeeeeee........eeeeeeeeeee...eeeeeeeee........eeeeeeeeee.....ee..hhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3r87 A   1 MSKIYHHPVQIYYEDTDHSGVVYHPNFLKYFERAREHVIDSDKLATLWNDHGLGFAVYKANMIFQDGVEFAEICDIRTSFTLDGKYKTLWRQEVWRPGASRAAVIGDIEMVCLDKEKRLQPVPADILASMMA 132
                                    10        20        30        40        50        60        70        80        90       100       110       120       130  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3R87)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3R87)

(-) Gene Ontology  (1, 1)

Asymmetric Unit(hide GO term definitions)
Chain A   (Q93CG9_9GAMM | Q93CG9)
molecular function
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3r87)
 
  Sites
(no "Sites" information available for 3r87)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3r87)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3r87
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q93CG9_9GAMM | Q93CG9
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q93CG9_9GAMM | Q93CG9
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q93CG9_9GAMM | Q93CG94i45

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3R87)