3R7W - JenaLib

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:289
 aligned with GTR1_YEAST | Q00582 from UniProtKB/Swiss-Prot  Length:310

    Alignment length:310
                             1                                                                                                                                                                                                                                                                                                                    
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309
           GTR1_YEAST     - -MSSNNRKKLLLMGRSGSGKSSMRSIIFSNYSAFDTRRLGATIDVEHSHLRFLGNMTLNLWDCGGQDVFMENYFTKQKDHIFQMVQVLIHVFDVESTEVLKDIEIFAKALKQLRKYSPDAKIFVLLHKMDLVQLDKREELFQIMMKNLSETSSEFGFPNLIGFPTSIWDESLYKAWSQIVCSLIPNMSNHQSNLKKFKEIMNALEIILFERTTFLVICSSNGENSNENHDSSDNNNVLLDPKRFEKISNIMKNFKQSCTKLKSGFKTLILNNNIYVSELSSNMVCFIVLKDMNIPQELVLENIKKAKEFF 309
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..ee----eeeee.....hhhhhhhhhhh...hhhhhhh.....eeeeeeee...eeeeeeee..hhhhhhhhhh.hhhhhhh...eeeeeee....hhhhhhhhhhhhhhhhhhhh...eeeeeeehhhhhhhhhhhhhhhhhhhhhhhhhhh......eeee.....hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhheeeeeeee.....eeee..-----------------...hhhhhhhhhhhhhhhhhhhhh..eeeeee...eeeee....eeeeeee.....hhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3r7w A   4 PLGS----KLLLmGRSGSGKSSmRSIIFSNYSAFDTRRLGATIDVEHSHLRFLGNmTLNLWDCGGQDVFmENYFTKQKDHIFQmVQVLIHVFDVESTEVLKDIEIFAKALKQLRKYSPDAKIFVLLHKmDLVQLDKREELFQImmKNLSETSSEFGFPNLIGFPTSIWDESLYKAWSQIVCSLIPNmSNHQSNLKKFKEImNALEIILFERTTFLVICSSN-----------------LDPKRFEKISNImKNFKQSCTKLKSGFKTLILNNNIYVSELSSNmVCFIVLKDmNIPQELVLENIKKAKEFF 309
                               |    |9  |     19  |     29        39        49     |  59        69        79   |    89        99       109       119       129       139   ||  149       159       169       179      |189       199|      209       219|        -       239       249|      259       269       279  |    289 |     299       309
                               7    8   |        22-MSE                           55-MSE        69-MSE        83-MSE                                      128-MSE        143-MSE                                    186-MSE       200-MSE             220               238         250-MSE                         282-MSE  291-MSE              
                                       12-MSE                                                                                                                             144-MSE

Chain B from PDB  Type:PROTEIN  Length:294
 aligned with GTR2_YEAST | P53290 from UniProtKB/Swiss-Prot  Length:341

    Alignment length:314
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320    
           GTR2_YEAST    11 MVLLMGVRRCGKSSICKVVFHNMQPLDTLYLESTSNPSLEHFSTLIDLAVMELPGQLNYFEPSYDSERLFKSVGALVYVIDSQDEYINAITNLAMIIEYAYKVNPSINIEVLIHKVDGLSEDFKVDAQRDIMQRTGEELLELGLDGVQVSFYLTSIFDHSIYEAFSRIVQKLIPELSFLENMLDNLIQHSKIEKAFLFDVNSKIYVSTDSNPVDIQMYEVCSEFIDVTIDLFDLYKAPVLRNSQKSSDKDNVINPRNELQNVSQLANGVIIYLRQMIRGLALVAIIRPNGTDMESCLTVADYNIDIFKKGLEDI 324
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee.......hhhhhhhhh...hhhhh..........eee.....eeeee..........hhhhhhhhh...eeeee.......hhhhhhhhhhhhhhhhhh...eeeee........hhhhhhhhhhhhhhhhhh..........eeee......hhhhhhhhhhhh....hhhhhhhhhhhhhh...eeeeeeee.......ee.....hhhhhhhhhhhhhhhhhhhh....--------------------..eeeeee....eeeeee....eeeeeee.....hhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3r7w B  11 mVLLmGVRRCGKSSICKVVFHNmQPLDTLYLESTSNPSLEHFSTLIDLAVmELPGQLNYFEPSYDSERLFKSVGALVYVIDSQDEYINAITNLAmIIEYAYKVNPSINIEVLIHKVDGLSEDFKVDAQRDImQRTGEELLELGLDGVQVSFYLTSIFDHSIYEAFSRIVQKLIPELSFLENmLDNLIQHSKIEKAFLFDVNSKIYVSTDSNPVDIQmYEVCSEFIDVTIDLFDLYKA--------------------ELQNVSQLANGVIIYLRQmIRGLALVAIIRPNGTDmESCLTVADYNIDIFKKGLEDI 324
                            |   |   20        30  |     40        50        60|       70        80        90       100    |  110       120       130       140 |     150       160       170       180       190 |     200       210       220      |230       240      |  -         -       270       280     | 290       300  |    310       320    
                           11-MSE                33-MSE                      61-MSE                                     105-MSE                              142-MSE                                           192-MSE                            227-MSE             247                  268               286-MSE          303-MSE                 
                               15-MSE

Chain C from PDB  Type:PROTEIN  Length:290
 aligned with GTR1_YEAST | Q00582 from UniProtKB/Swiss-Prot  Length:310

    Alignment length:311
                             1                                                                                                                                                                                                                                                                                                                     
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309 
           GTR1_YEAST     - -MSSNNRKKLLLMGRSGSGKSSMRSIIFSNYSAFDTRRLGATIDVEHSHLRFLGNMTLNLWDCGGQDVFMENYFTKQKDHIFQMVQVLIHVFDVESTEVLKDIEIFAKALKQLRKYSPDAKIFVLLHKMDLVQLDKREELFQIMMKNLSETSSEFGFPNLIGFPTSIWDESLYKAWSQIVCSLIPNMSNHQSNLKKFKEIMNALEIILFERTTFLVICSSNGENSNENHDSSDNNNVLLDPKRFEKISNIMKNFKQSCTKLKSGFKTLILNNNIYVSELSSNMVCFIVLKDMNIPQELVLENIKKAKEFFQ 310
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...e----eeeee.....hhhhhhhhhhh....hhhhhh.....eeeeeeee...eeeeeeee..hhhhhhhhhh.hhhhhhh.eeeeeeeee....hhhhhhhhhhhhhhhhhhhh...eeeeeee.....hhhhhhhhhhhhhhhhhhhhhh......eeeee....hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhheeeeeeee.....eeee..-----------------...hhhhhhhhhhhhhhhhhh.......eeee...eeeee....eeeeeee.....hhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3r7w C   4 PLGS----KLLLmGRSGSGKSSmRSIIFSNYSAFDTRRLGATIDVEHSHLRFLGNmTLNLWDCGGQDVFmENYFTKQKDHIFQmVQVLIHVFDVESTEVLKDIEIFAKALKQLRKYSPDAKIFVLLHKmDLVQLDKREELFQImmKNLSETSSEFGFPNLIGFPTSIWDESLYKAWSQIVCSLIPNmSNHQSNLKKFKEImNALEIILFERTTFLVICSSN-----------------LDPKRFEKISNImKNFKQSCTKLKSGFKTLILNNNIYVSELSSNmVCFIVLKDmNIPQELVLENIKKAKEFFQ 310
                               |    |9  |     19  |     29        39        49     |  59        69        79   |    89        99       109       119       129       139   ||  149       159       169       179      |189       199|      209       219|        -       239       249|      259       269       279  |    289 |     299       309 
                               7    8   |        22-MSE                           55-MSE        69-MSE        83-MSE                                      128-MSE        143-MSE                                    186-MSE       200-MSE             220               238         250-MSE                         282-MSE  291-MSE               
                                       12-MSE                                                                                                                             144-MSE

Chain D from PDB  Type:PROTEIN  Length:229
 aligned with GTR2_YEAST | P53290 from UniProtKB/Swiss-Prot  Length:341

    Alignment length:314
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320    
           GTR2_YEAST    11 MVLLMGVRRCGKSSICKVVFHNMQPLDTLYLESTSNPSLEHFSTLIDLAVMELPGQLNYFEPSYDSERLFKSVGALVYVIDSQDEYINAITNLAMIIEYAYKVNPSINIEVLIHKVDGLSEDFKVDAQRDIMQRTGEELLELGLDGVQVSFYLTSIFDHSIYEAFSRIVQKLIPELSFLENMLDNLIQHSKIEKAFLFDVNSKIYVSTDSNPVDIQMYEVCSEFIDVTIDLFDLYKAPVLRNSQKSSDKDNVINPRNELQNVSQLANGVIIYLRQMIRGLALVAIIRPNGTDMESCLTVADYNIDIFKKGLEDI 324
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee....hhhhhhhh...-----------------------------------------------------.eeee..-----hhhhhhhhhhhhhhhh......eeeee..-------hhhhhhhhhhhhhhhhh..........eeee.....hhhhhhhhhhhhh............hhhhh...eeeee.................hhhhhhhhhhhhhhhhhhhhhh..--------------------..eeeee.....eeeeee.....eeeeee.....hhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3r7w D  11 mVLLmGVRRCGKSSICKVVFH-----------------------------------------------------ALVYVID-----INAITNLAmIIEYAYKVNPSINIEVLIHK-------FKVDAQRDImQRTGEELLELGLDGVQVSFYLTSIFDHSIYEAFSRIVQKLIPELSFLENmLDNLIQHSKIEKAFLFDVNSKIYVSTDSNPVDIQmYEVCSEFIDVTIDLFDLYKA--------------------ELQNVSQLANGVIIYLRQmIRGLALVAIIRPNGTDmESCLTVADYNIDIFKKGLEDI 324
                            |   |   20        30|        -         -         -         -         -    |   90|     |100    |  110       120    |    -  |    140 |     150       160       170       180       190 |     200       210       220      |230       240      |  -         -       270       280     | 290       300  |    310       320    
                           11-MSE              31                                                    85    91    97     105-MSE             125     133      142-MSE                                           192-MSE                            227-MSE             247                  268               286-MSE          303-MSE                 
                               15-MSE

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit(hide GO term definitions)

Chain A,C (GTR1_YEAST | Q00582)

molecular function
	GO:0005525	GTP binding	Interacting selectively and non-covalently with GTP, guanosine triphosphate.
	GO:0003924	GTPase activity	Catalysis of the reaction: GTP + H2O = GDP + phosphate.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
	GO:0071230	cellular response to amino acid stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an amino acid stimulus. An amino acid is a carboxylic acids containing one or more amino groups.
	GO:0009267	cellular response to starvation	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of deprivation of nourishment.
	GO:0006348	chromatin silencing at telomere	Repression of transcription of telomeric DNA by altering the structure of chromatin.
	GO:0010507	negative regulation of autophagy	Any process that stops, prevents, or reduces the frequency, rate or extent of autophagy. Autophagy is the process in which cells digest parts of their own cytoplasm.
	GO:0006817	phosphate ion transport	The directed movement of phosphate into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:1904263	positive regulation of TORC1 signaling	Any process that activates or increases the frequency, rate or extent of TORC1 signaling.
	GO:1903778	protein localization to vacuolar membrane	A process in which a protein is transported to, or maintained in, a location within a vacuolar membrane.
	GO:0015031	protein transport	The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006360	transcription from RNA polymerase I promoter	The synthesis of RNA from a DNA template by RNA polymerase I (RNAP I), originating at an RNAP I promoter.
	GO:0006383	transcription from RNA polymerase III promoter	The synthesis of RNA from a DNA template by RNA polymerase III, originating at an RNAP III promoter.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0034448	EGO complex	A vacuolar membrane-associated protein complex that is required for activation of microautophagy during exit from rapamycin-induced growth arrest. In budding yeast, S. cerevisiae, this complex includes Gtr1p, Gtr2p, Meh1p, and Slm4p.
	GO:1990131	Gtr1-Gtr2 GTPase complex	A heterodimer GTPase complex. In S. cerevisiae, this complex contains Gtr1p and Gtr2p proteins.
	GO:0000781	chromosome, telomeric region	The terminal region of a linear chromosome that includes the telomeric DNA repeats and associated proteins.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0000329	fungal-type vacuole membrane	The lipid bilayer surrounding a vacuole, the shape of which correlates with cell cycle phase. The membrane separates its contents from the cytoplasm of the cell. An example of this structure is found in Saccharomyces cerevisiae.
	GO:0031902	late endosome membrane	The lipid bilayer surrounding a late endosome.
	GO:0005764	lysosome	A small lytic vacuole that has cell cycle-independent morphology and is found in most animal cells and that contains a variety of hydrolases, most of which have their maximal activities in the pH range 5-6. The contained enzymes display latency if properly isolated. About 40 different lysosomal hydrolases are known and lysosomes have a great variety of morphologies and functions.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005774	vacuolar membrane	The lipid bilayer surrounding the vacuole and separating its contents from the cytoplasm of the cell.
	GO:0005773	vacuole	A closed structure, found only in eukaryotic cells, that is completely surrounded by unit membrane and contains liquid material. Cells contain one or several vacuoles, that may have different functions from each other. Vacuoles have a diverse array of functions. They can act as a storage organelle for nutrients or waste products, as a degradative compartment, as a cost-effective way of increasing cell size, and as a homeostatic regulator controlling both turgor pressure and pH of the cytosol.

Chain B,D (GTR2_YEAST | P53290)

molecular function
	GO:0005525	GTP binding	Interacting selectively and non-covalently with GTP, guanosine triphosphate.
	GO:0003924	GTPase activity	Catalysis of the reaction: GTP + H2O = GDP + phosphate.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006914	autophagy	The process in which cells digest parts of their own cytoplasm; allows for both recycling of macromolecular constituents under conditions of cellular stress and remodeling the intracellular structure for cell differentiation.
	GO:0071230	cellular response to amino acid stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an amino acid stimulus. An amino acid is a carboxylic acids containing one or more amino groups.
	GO:0009267	cellular response to starvation	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of deprivation of nourishment.
	GO:0016237	lysosomal microautophagy	The transfer of cytosolic components into the lysosomal compartment by direct invagination of the lysosomal membrane without prior sequestration into an autophagosome. The engulfing membranes fuse, resulting in the lysosomal delivery of the cargo wrapped in a single membrane derived from the invaginated lysosomal membrane. In S. cerevisiae, the vacuole is the lysosomal compartment.
	GO:0010507	negative regulation of autophagy	Any process that stops, prevents, or reduces the frequency, rate or extent of autophagy. Autophagy is the process in which cells digest parts of their own cytoplasm.
	GO:0043547	positive regulation of GTPase activity	Any process that activates or increases the activity of a GTPase.
	GO:1904263	positive regulation of TORC1 signaling	Any process that activates or increases the frequency, rate or extent of TORC1 signaling.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:1903778	protein localization to vacuolar membrane	A process in which a protein is transported to, or maintained in, a location within a vacuolar membrane.
	GO:0015031	protein transport	The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0034448	EGO complex	A vacuolar membrane-associated protein complex that is required for activation of microautophagy during exit from rapamycin-induced growth arrest. In budding yeast, S. cerevisiae, this complex includes Gtr1p, Gtr2p, Meh1p, and Slm4p.
	GO:1990131	Gtr1-Gtr2 GTPase complex	A heterodimer GTPase complex. In S. cerevisiae, this complex contains Gtr1p and Gtr2p proteins.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0000329	fungal-type vacuole membrane	The lipid bilayer surrounding a vacuole, the shape of which correlates with cell cycle phase. The membrane separates its contents from the cytoplasm of the cell. An example of this structure is found in Saccharomyces cerevisiae.
	GO:0031902	late endosome membrane	The lipid bilayer surrounding a late endosome.
	GO:0005764	lysosome	A small lytic vacuole that has cell cycle-independent morphology and is found in most animal cells and that contains a variety of hydrolases, most of which have their maximal activities in the pH range 5-6. The contained enzymes display latency if properly isolated. About 40 different lysosomal hydrolases are known and lysosomes have a great variety of morphologies and functions.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0000790	nuclear chromatin	The ordered and organized complex of DNA, protein, and sometimes RNA, that forms the chromosome in the nucleus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005774	vacuolar membrane	The lipid bilayer surrounding the vacuole and separating its contents from the cytoplasm of the cell.
	GO:0005773	vacuole	A closed structure, found only in eukaryotic cells, that is completely surrounded by unit membrane and contains liquid material. Cells contain one or several vacuoles, that may have different functions from each other. Vacuoles have a diverse array of functions. They can act as a storage organelle for nutrients or waste products, as a degradative compartment, as a cost-effective way of increasing cell size, and as a homeostatic regulator controlling both turgor pressure and pH of the cytosol.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 52)

Sites (8, 8)

SS Bonds (0, 0)

Cis Peptide Bonds (5, 5)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (31, 51)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File