Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF O-METHYLTRANSFERASE FROM LEGIONELLA PNEUMOPHILA
 
Authors :  R. Agarwal, S. C. Almo, S. Swaminathan, New York Structural Genomic Research Consortium (Nysgrc)
Date :  15 Mar 11  (Deposition) - 06 Apr 11  (Release) - 06 Apr 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.65
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Structural Genomics, Psi-Biology, New York Structural Genomics Research Consortium, Nysgrc, O-Methyltransferase, 000563, Sam Dependent, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. Agarwal, S. C. Almo, S. Swaminathan
Crystal Structure Of O-Methyltransferase From Legionella Pneumophila
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - O-METHYLTRANSFERASE, SAM-DEPENDENT
    Chains: A, B
    EC Number: 2.1.1.-
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET
    Expression System Strain: BL21(DE3)RIPL
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: LPG2277
    Organism Scientific: LEGIONELLA PNEUMOPHILA SUBSP. PNEUMOPHILA
    Organism Taxid: 272624
    Strain: PHILADELPHIA 1 / ATCC 33152 / DSM 7513

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3R3H)

(-) Sites  (0, 0)

(no "Site" information available for 3R3H)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3R3H)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3R3H)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3R3H)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3R3H)

(-) Exons   (0, 0)

(no "Exon" information available for 3R3H)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:217
 aligned with Q5ZT85_LEGPH | Q5ZT85 from UniProtKB/TrEMBL  Length:218

    Alignment length:217
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       
         Q5ZT85_LEGPH     2 KHLSLTPELYKYLLDISLREHPALAALRKETSTMELANMQVAPEQAQFMQMLIRLTRAKKVLELGTFTGYSALAMSLALPDDGQVITCDINEGWTKHAHPYWREAKQEHKIKLRLGPALDTLHSLLNEGGEHQFDFIFIDADKTNYLNYYELALKLVTPKGLIAIDNIFWDGKVIDPNDTSGQTREIKKLNQVIKNDSRVFVSLLAIADGMFLVQPI 218
               SCOP domains d3r3ha_ A: automated matches                                                                                                                                                                                              SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhh..hhhhhhhhhh...hhhhhh..hhhhhhhhhhhhhhhh..eeeeee...hhhhhhhhhh.....eeeeee........hhhhhhhh.....eeeee.hhhhhhhhhhhhhh...eeeeeee.hhhhhhhhhhhhhhheeeeeeeeee..............hhhhhhhhhhhhhhhh...eeeeee.....eeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3r3h A   4 KHLSLTPELYKYLLDISLREHPALAALRKETSTMELANMQVAPEQAQFMQMLIRLTRAKKVLELGTFTGYSALAMSLALPDDGQVITCDINEGWTKHAHPYWREAKQEHKIKLRLGPALDTLHSLLNEGGEHQFDFIFIDADKTNYLNYYELALKLVTPKGLIAIDNIFWDGKVIDPNDTSGQTREIKKLNQVIKNDSRVFVSLLAIADGMFLVQPI 220
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       


Chain B from PDB  Type:PROTEIN  Length:217
 aligned with Q5ZT85_LEGPH | Q5ZT85 from UniProtKB/TrEMBL  Length:218

    Alignment length:217
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       
         Q5ZT85_LEGPH     2 KHLSLTPELYKYLLDISLREHPALAALRKETSTMELANMQVAPEQAQFMQMLIRLTRAKKVLELGTFTGYSALAMSLALPDDGQVITCDINEGWTKHAHPYWREAKQEHKIKLRLGPALDTLHSLLNEGGEHQFDFIFIDADKTNYLNYYELALKLVTPKGLIAIDNIFWDGKVIDPNDTSGQTREIKKLNQVIKNDSRVFVSLLAIADGMFLVQPI 218
               SCOP domains d3r3hb_ B: automated matches                                                                                                                                                                                              SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -------------Methyltransf_3-3r3hB01 B:17-220                                                                                                                                                                              Pfam domains (1)
           Pfam domains (2) -------------Methyltransf_3-3r3hB02 B:17-220                                                                                                                                                                              Pfam domains (2)
         Sec.struct. author .....hhhhhhhhhhhhh..hhhhhhhhhhh..........hhhhhhhhhhhhhhhh..eeeeee...hhhhhhhhhhh....eeeeee........hhhhhhhh.....eeeee.hhhhhhhhhhh......eeeeeee.hhhhhhhhhhhhhhheeeeeeeee...hhhhh.......hhhhhhhhhhhhhhhh...ee..ee.....eeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3r3h B   4 KHLSLTPELYKYLLDISLREHPALAALRKETSTMELANMQVAPEQAQFMQMLIRLTRAKKVLELGTFTGYSALAMSLALPDDGQVITCDINEGWTKHAHPYWREAKQEHKIKLRLGPALDTLHSLLNEGGEHQFDFIFIDADKTNYLNYYELALKLVTPKGLIAIDNIFWDGKVIDPNDTSGQTREIKKLNQVIKNDSRVFVSLLAIADGMFLVQPI 220
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3R3H)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: NADP_Rossmann (1239)

(-) Gene Ontology  (4, 4)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q5ZT85_LEGPH | Q5ZT85)
molecular function
    GO:0008171    O-methyltransferase activity    Catalysis of the transfer of a methyl group to the oxygen atom of an acceptor molecule.
    GO:0008168    methyltransferase activity    Catalysis of the transfer of a methyl group to an acceptor molecule.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0032259    methylation    The process in which a methyl group is covalently attached to a molecule.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3r3h)
 
  Sites
(no "Sites" information available for 3r3h)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3r3h)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3r3h
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q5ZT85_LEGPH | Q5ZT85
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.1.1.-
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q5ZT85_LEGPH | Q5ZT85
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3R3H)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3R3H)