Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF ENOYL-COA HYDRATASE ECHA1 FROM MYCOBACTERIUM MARINUM
 
Authors :  Seattle Structural Genomics Center For Infectious Disease (S
Date :  01 Mar 11  (Deposition) - 16 Mar 11  (Release) - 22 Apr 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym./Biol. Unit :  A,B,C
Keywords :  Structural Genomics, Seattle Structural Genomics Center For Infectious Disease, Ssgcid, Mycobacterium, Tuberculosis, Marinum, Water-Borne Pathogen, Fatty Acid Synthesis, Enoyl-Coa, Coenzyme A, Hydratase, Lyase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  L. Baugh, I. Phan, D. W. Begley, M. C. Clifton, B. Armour, D. M. Dranow, B. M. Taylor, M. M. Muruthi, J. Abendroth, J. W. Fairman, D. Fox, S. H. Dieterich, B. L. Staker, A. S. Gardberg, R. Choi, S. N. Hewitt, A. J. Napuli, J. Myers, L. K. Barrett, Y. Zhang, M. Ferrell, E. Mundt, K. Thompkins, N. Tran, S. Lyons-Abbott, A. Abramov, A. Sekar, D. Serbzhinskiy, D. Lorimer, G. W. Buchko, R. Stacy, L. J. Stewart, T. E. Edwards, W. C. Van Voorhis, P. J. Myler
Increasing The Structural Coverage Of Tuberculosis Drug Targets.
Tuberculosis (Edinb) V. 95 142 2015
PubMed-ID: 25613812  |  Reference-DOI: 10.1016/J.TUBE.2014.12.003

(-) Compounds

Molecule 1 - ENOYL-COA HYDRATASE ECHA1
    Chains: A, B, C
    EC Number: 4.2.1.17
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Expression System Vector Type: PAVA0421
    Gene: ECHA1, MMAR_0465
    Organism Scientific: MYCOBACTERIUM MARINUM
    Organism Taxid: 216594
    Strain: ATCC BAA-535 / M

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit : ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3QXI)

(-) Sites  (0, 0)

(no "Site" information available for 3QXI)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3QXI)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3QXI)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3QXI)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3QXI)

(-) Exons   (0, 0)

(no "Exon" information available for 3QXI)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:244
 aligned with B2HMZ1_MYCMM | B2HMZ1 from UniProtKB/TrEMBL  Length:260

    Alignment length:251
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259 
         B2HMZ1_MYCMM    10 PEVLVEQRDRILIITINRPKAKNSVNAAVSRALADAMDRLDADAGLSVGILTGAGGSFCAGMDLKAFARGENVVVEGRGLGFTERPPAKPLIAAVEGYALAGGTELALATDLIVAARDSAFGIPEVKRGLVAGGGGLLRLPERIPYAIAMELALTGDNLSAERAHALGMVNVLAEPGAALDAAIALAEKITANGPLAVAATKRIITESRGWSLDTRFAQQMKILFPIFTSNDAKEGAIAFAEKRPPRWTGT 260
               SCOP domains d3qxia_ A: automated matches                                                                                                                                                                                                                                SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee..eeeeee.hhhhh...hhhhhhhhhhhhhhhhhh....eeeeee..........-------...ee...ee..........eeeee..eeehhhhhhhhhh.eeeee...eeehhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh..eehhhhhhh....eee...hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3qxi A  10 PEVLVEQRDRILIITINRPKAKNSVNAAVSRALADAMDRLDADAGLSVGILTGAGGSFCAGMD-------ENVVVEGRGLGFTERPPAKPLIAAVEGYALAGGTELALATDLIVAARDSAFGIPEVKRGLVAGGGGLLRLPERIPYAIAMELALTGDNLSAERAHALGMVNVLAEPGAALDAAIALAEKITANGPLAVAATKRIITESRGWSLDTRFAQQMKILFPIFTSNDAKEGAIAFAEKRPPRWTGT 260
                                    19        29        39        49        59        69  |      -|       89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259 
                                                                                         72      80                                                                                                                                                                                    


Chain B from PDB  Type:PROTEIN  Length:252
 aligned with B2HMZ1_MYCMM | B2HMZ1 from UniProtKB/TrEMBL  Length:260

    Alignment length:252
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258  
         B2HMZ1_MYCMM     9 EPEVLVEQRDRILIITINRPKAKNSVNAAVSRALADAMDRLDADAGLSVGILTGAGGSFCAGMDLKAFARGENVVVEGRGLGFTERPPAKPLIAAVEGYALAGGTELALATDLIVAARDSAFGIPEVKRGLVAGGGGLLRLPERIPYAIAMELALTGDNLSAERAHALGMVNVLAEPGAALDAAIALAEKITANGPLAVAATKRIITESRGWSLDTRFAQQMKILFPIFTSNDAKEGAIAFAEKRPPRWTGT 260
               SCOP domains d3qxib_ B: automated matches                                                                                                                                                                                                                                 SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeeee..eeeeee.hhhhh...hhhhhhhhhhhhhhhhhh....eeeeee.........hhhhhhhh....................eeeee..eeehhhhhhhhhh.eeeee...eee.hhhhhh.....hhhhhhhhhhhhhhhhhhhhhh..eehhhhhhh....eee...hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3qxi B   9 EPEVLVEQRDRILIITINRPKAKNSVNAAVSRALADAMDRLDADAGLSVGILTGAGGSFCAGMDLKAFARGENVVVEGRGLGFTERPPAKPLIAAVEGYALAGGTELALATDLIVAARDSAFGIPEVKRGLVAGGGGLLRLPERIPYAIAMELALTGDNLSAERAHALGMVNVLAEPGAALDAAIALAEKITANGPLAVAATKRIITESRGWSLDTRFAQQMKILFPIFTSNDAKEGAIAFAEKRPPRWTGT 260
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258  


Chain C from PDB  Type:PROTEIN  Length:252
 aligned with B2HMZ1_MYCMM | B2HMZ1 from UniProtKB/TrEMBL  Length:260

    Alignment length:252
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258  
         B2HMZ1_MYCMM     9 EPEVLVEQRDRILIITINRPKAKNSVNAAVSRALADAMDRLDADAGLSVGILTGAGGSFCAGMDLKAFARGENVVVEGRGLGFTERPPAKPLIAAVEGYALAGGTELALATDLIVAARDSAFGIPEVKRGLVAGGGGLLRLPERIPYAIAMELALTGDNLSAERAHALGMVNVLAEPGAALDAAIALAEKITANGPLAVAATKRIITESRGWSLDTRFAQQMKILFPIFTSNDAKEGAIAFAEKRPPRWTGT 260
               SCOP domains d3qxic_ C: automated matches                                                                                                                                                                                                                                 SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
           Pfam domains (1) ----ECH-3qxiC01 C:13-252                                                                                                                                                                                                                            -------- Pfam domains (1)
           Pfam domains (2) ----ECH-3qxiC02 C:13-252                                                                                                                                                                                                                            -------- Pfam domains (2)
           Pfam domains (3) ----ECH-3qxiC03 C:13-252                                                                                                                                                                                                                            -------- Pfam domains (3)
         Sec.struct. author ...eeeeee..eeeeee.hhhhh...hhhhhhhhhhhhhhhhhh....eeeeee.........hhhhhhh.....................eeeee..eeehhhhhhhhhh.eeeee...eee.hhhhhh.....hhhhhhhhhhhhhhhhhhhhhh.eeehhhhhhh....eee...hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhh.hhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3qxi C   9 EPEVLVEQRDRILIITINRPKAKNSVNAAVSRALADAMDRLDADAGLSVGILTGAGGSFCAGMDLKAFARGENVVVEGRGLGFTERPPAKPLIAAVEGYALAGGTELALATDLIVAARDSAFGIPEVKRGLVAGGGGLLRLPERIPYAIAMELALTGDNLSAERAHALGMVNVLAEPGAALDAAIALAEKITANGPLAVAATKRIITESRGWSLDTRFAQQMKILFPIFTSNDAKEGAIAFAEKRPPRWTGT 260
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 3)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3QXI)

(-) Pfam Domains  (1, 3)

Asymmetric/Biological Unit
(-)
Clan: ClpP_crotonase (88)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C   (B2HMZ1_MYCMM | B2HMZ1)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
biological process
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3qxi)
 
  Sites
(no "Sites" information available for 3qxi)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3qxi)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3qxi
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  B2HMZ1_MYCMM | B2HMZ1
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  4.2.1.17
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  B2HMZ1_MYCMM | B2HMZ1
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3QXI)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3QXI)