|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 3QWS) |
(no "Site" information available for 3QWS) |
(no "SS Bond" information available for 3QWS) |
(no "Cis Peptide Bond" information available for 3QWS) |
(no "SAP(SNP)/Variant" information available for 3QWS) |
(no "PROSITE Motif" information available for 3QWS) |
(no "Exon" information available for 3QWS) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:62 aligned with Q37964_BPN15 | Q37964 from UniProtKB/TrEMBL Length:71 Alignment length:62 10 20 30 40 50 60 Q37964_BPN15 1 MKPEELVRHFGDVEKAAVGVGVTPGAVYQWLQAGEIPPLRQSDIEVRTAYKLKSDFTSQRMG 62 SCOP domains -------------------------------------------------------------- SCOP domains CATH domains -------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------- Transcript 3qws A 1 MKPEELVRHFGDVEKAAVGVGVTPGAVYQWLQAGEIPPLRQSDIEVRTAYKLKSDFTSQRMG 62 10 20 30 40 50 60 Chain B from PDB Type:PROTEIN Length:63 aligned with Q37964_BPN15 | Q37964 from UniProtKB/TrEMBL Length:71 Alignment length:63 10 20 30 40 50 60 Q37964_BPN15 1 MKPEELVRHFGDVEKAAVGVGVTPGAVYQWLQAGEIPPLRQSDIEVRTAYKLKSDFTSQRMGK 63 SCOP domains --------------------------------------------------------------- SCOP domains CATH domains --------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------- Transcript 3qws B 1 MKPEELVRHFGDVEKAAVGVGVTPGAVYQWLQAGEIPPLRQSDIEVRTAYKLKSDFTSQRMGK 63 10 20 30 40 50 60 Chain C from PDB Type:DNA Length:17 3qws C 1 TTTATAGCTAGCTATAA 17 10 Chain N from PDB Type:DNA Length:17 3qws N 1 TTTATAGCTAGCTATAA 17 10
|
(no "SCOP Domain" information available for 3QWS) |
(no "CATH Domain" information available for 3QWS) |
(no "Pfam Domain" information available for 3QWS) |
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (Q37964_BPN15 | Q37964)
|
|
|
|
|
|
|