Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  ALLANTOIN RACEMASE FROM KLEBSIELLA PNEUMONIAE
 
Authors :  J. B. French, D. B. Neau, S. E. Ealick
Date :  25 Feb 11  (Deposition) - 04 May 11  (Release) - 06 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.82
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (6x)
Biol. Unit 2:  B  (6x)
Keywords :  Isomerase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. B. French, D. B. Neau, S. E. Ealick
Characterization Of The Structure And Function Of Klebsiell Pneumoniae Allantoin Racemase.
J. Mol. Biol. V. 410 447 2011
PubMed-ID: 21616082  |  Reference-DOI: 10.1016/J.JMB.2011.05.016

(-) Compounds

Molecule 1 - PUTATIVE HYDANTOIN RACEMASE
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: HPXA, KPN78578_17580, KPN_01788
    Organism Scientific: KLEBSIELLA PNEUMONIAE SUBSP. PNEUMONIAE
    Organism Taxid: 272620
    Strain: ATCC 700721 / MGH 78578

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (6x): A 
Biological Unit 2 (6x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
15HY2Ligand/Ion[(4R)-2,5-DIOXOIMIDAZOLIDIN-4-YL]ACETIC ACID
Biological Unit 1 (1, 6)
No.NameCountTypeFull Name
15HY6Ligand/Ion[(4R)-2,5-DIOXOIMIDAZOLIDIN-4-YL]ACETIC ACID
Biological Unit 2 (1, 6)
No.NameCountTypeFull Name
15HY6Ligand/Ion[(4R)-2,5-DIOXOIMIDAZOLIDIN-4-YL]ACETIC ACID

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASN A:12 , ILE A:47 , SER A:79 , PHE A:80 , THR A:118 , THR A:119 , VAL A:150 , GLY A:183 , SER A:184 , GLY A:185 , HOH A:308 , HOH A:327BINDING SITE FOR RESIDUE 5HY A 1
2AC2SOFTWAREASN B:12 , ILE B:47 , SER B:79 , PHE B:80 , THR B:118 , THR B:119 , VAL B:150 , GLY B:183 , SER B:184 , GLY B:185 , HOH B:314 , HOH B:342BINDING SITE FOR RESIDUE 5HY B 1

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3QVL)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3QVL)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3QVL)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3QVL)

(-) Exons   (0, 0)

(no "Exon" information available for 3QVL)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:245
 aligned with A6T9E8_KLEP7 | A6T9E8 from UniProtKB/TrEMBL  Length:247

    Alignment length:245
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242     
         A6T9E8_KLEP7     3 SVRIQVINPNTSLAMTETIGAAARAVAAPGTEILAVCPRAGVPSIEGHFDEAIAAVGVLEQIRAGREQGVDGHVIACFGDPGLLAARELAQGPVIGIAEAAMHMATMVATRFSIVTTLPRTLIIARHLLHQYGFHQHCAALHAIDLPVLALEDGSGLAQEKVRERCIRALKEDGSGAIVLGCGGMATLAQELTRELRVPVIDGVSAAVKMVESLVALGLATSKHGDLAFPEKKALSGQFQSLNPF 247
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee....hhhhhhhhhhhhhhhh...eeeeee..........hhhhhhhhhhhhhhhhhhhhhhh..eeee......hhhhhhhhh...eeehhhhhhhhhhhhh..eeeee.hhhhhhhhhhhhhhhhhhh.eeeeee...hhhhhhh..hhhhhhhhhhhhhhhhhh...eeee.hhhhhhhhhhhhhhhh..eehhhhhhhhhhhhhhhh..................hhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3qvl A   3 SVRIQVINPNTSLAMTETIGAAARAVAAPGTEILAVCPRAGVPSIEGHFDEAIAAVGVLEQIRAGREQGVDGHVIASFGDPGLLAARELAQGPVIGIAEAAMHMATMVATRFSIVTTLPRTLIIARHLLHQYGFHQHCAALHAIDLPVLALEDGSGLAQEKVRERCIRALKEDGSGAIVLGSGGMATLAQQLTRELRVPVIDGVSAAVKMVESLVALGLATSKHGDLAFPEKKALSGQFQSLNPF 247
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242     


Chain B from PDB  Type:PROTEIN  Length:245
 aligned with A6T9E8_KLEP7 | A6T9E8 from UniProtKB/TrEMBL  Length:247

    Alignment length:245
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242     
         A6T9E8_KLEP7     3 SVRIQVINPNTSLAMTETIGAAARAVAAPGTEILAVCPRAGVPSIEGHFDEAIAAVGVLEQIRAGREQGVDGHVIACFGDPGLLAARELAQGPVIGIAEAAMHMATMVATRFSIVTTLPRTLIIARHLLHQYGFHQHCAALHAIDLPVLALEDGSGLAQEKVRERCIRALKEDGSGAIVLGCGGMATLAQELTRELRVPVIDGVSAAVKMVESLVALGLATSKHGDLAFPEKKALSGQFQSLNPF 247
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ---Asp_Glu_race-3qvlB01 B:6-214                                                                                                                                                                                     --------------------------------- Pfam domains (1)
           Pfam domains (2) ---Asp_Glu_race-3qvlB02 B:6-214                                                                                                                                                                                     --------------------------------- Pfam domains (2)
         Sec.struct. author .eeeeee....hhhhhhhhhhhhhhhh...eeeeee..........hhhhhhhhhhhhhhhhhhhhhhh..eeee......hhhhhhhhh...eeehhhhhhhhhhhhh..eeeee.hhhhhhhhhhhhhhhhhhh.eeeeee...hhhhhhh..hhhhhhhhhhhhhhhhhh...eeeeehhhhhhhhhhhhhhhh..eehhhhhhhhhhhhhhhh..................hhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3qvl B   3 SVRIQVINPNTSLAMTETIGAAARAVAAPGTEILAVCPRAGVPSIEGHFDEAIAAVGVLEQIRAGREQGVDGHVIASFGDPGLLAARELAQGPVIGIAEAAMHMATMVATRFSIVTTLPRTLIIARHLLHQYGFHQHCAALHAIDLPVLALEDGSGLAQEKVRERCIRALKEDGSGAIVLGSGGMATLAQQLTRELRVPVIDGVSAAVKMVESLVALGLATSKHGDLAFPEKKALSGQFQSLNPF 247
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3QVL)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3QVL)

(-) Pfam Domains  (1, 2)

Asymmetric Unit
(-)
Clan: Asp-glut_race (23)

(-) Gene Ontology  (2, 2)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (A6T9E8_KLEP7 | A6T9E8)
molecular function
    GO:0036361    racemase activity, acting on amino acids and derivatives    Catalysis of the interconversion of the two enantiomers of a chiral amino acid or amino acid derivative.
biological process
    GO:0006807    nitrogen compound metabolic process    The chemical reactions and pathways involving organic or inorganic compounds that contain nitrogen.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    5HY  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3qvl)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3qvl
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A6T9E8_KLEP7 | A6T9E8
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  A6T9E8_KLEP7 | A6T9E8
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        A6T9E8_KLEP7 | A6T9E8: 3qvj 3qvk

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3QVL)