|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 10)| Asymmetric Unit (3, 10) Biological Unit 1 (1, 10) |
Sites (5, 5)
Asymmetric Unit (5, 5)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3QOO) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3QOO) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3QOO) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3QOO) |
Exons (0, 0)| (no "Exon" information available for 3QOO) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:135 aligned with D1B956_THEAS | D1B956 from UniProtKB/TrEMBL Length:135 Alignment length:135 10 20 30 40 50 60 70 80 90 100 110 120 130 D1B956_THEAS 1 MDFNELFPVGTYRRMVKKVSVSDTVTNRSKALEEFMSTAAFLETMTQLAVEILDHKLPEGFVSVGVRSEVHNLAPAVLGDDVTFTVTVDRVEGNRVVLSMKADDPHGPVATGLQERVVVSTDLLEKRVWERFGGR 135 SCOP domains --------------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains --------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------------------------------------- Transcript 3qoo A 1 mDFNELFPVGTYRRmVKKVSVSDTVTNRSKALEEFmSTAAFLETmTQLAVEILDHKLPEGFVSVGVRSEVHNLAPAVLGDDVTFTVTVDRVEGNRVVLSmKADDPHGPVATGLQERVVVSTDLLEKRVWERFGGR 135 | 10 | 20 30 | 40 | 50 60 70 80 90 100 110 120 130 | 15-MSE 36-MSE 45-MSE 100-MSE 1-MSE
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3QOO) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3QOO) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3QOO) |
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 3QOO)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|