Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF APO BOLETUS EDULIS LECTIN
 
Authors :  M. Bovi, M. E. Carrizo, S. Capaldi, M. Perduca, L. R. Chiarelli, M. Galli H. L. Monaco
Date :  19 Jan 11  (Deposition) - 23 Feb 11  (Release) - 02 Nov 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.15
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (2x)
Biol. Unit 2:  A  (2x)
Biol. Unit 3:  B  (2x)
Keywords :  Boletus Edulis, Lectin, Mushroom, T-Antigen, Carbohydrate, Sugar Binding, Sugar Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Bovi, M. E. Carrizo, S. Capaldi, M. Perduca, L. R. Chiarelli, M. Galliano, H. L. Monaco
Structure Of A Lectin With Antitumoral Properties In King Bolete (Boletus Edulis) Mushrooms.
Glycobiology V. 21 1000 2011
PubMed-ID: 21303815  |  Reference-DOI: 10.1093/GLYCOB/CWR012

(-) Compounds

Molecule 1 - BOLETUS EDULIS LECTIN
    Chains: A, B
    Organism Scientific: BOLETUS EDULIS
    Organism Taxid: 36056

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (2x): AB
Biological Unit 2 (2x): A 
Biological Unit 3 (2x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1ACE2Mod. Amino AcidACETYL GROUP
Biological Unit 1 (1, 4)
No.NameCountTypeFull Name
1ACE4Mod. Amino AcidACETYL GROUP
Biological Unit 2 (1, 2)
No.NameCountTypeFull Name
1ACE2Mod. Amino AcidACETYL GROUP
Biological Unit 3 (1, 2)
No.NameCountTypeFull Name
1ACE2Mod. Amino AcidACETYL GROUP

(-) Sites  (0, 0)

(no "Site" information available for 3QDS)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3QDS)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3QDS)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3QDS)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3QDS)

(-) Exons   (0, 0)

(no "Exon" information available for 3QDS)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:143
 aligned with BEL_BOLED | F2Z266 from UniProtKB/Swiss-Prot  Length:143

    Alignment length:143
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140   
            BEL_BOLED     1 MTYSITLRVFQRNPGRGFFSIVEKTVFHYANGGTWSEAKGTHTLTMGGSGTSGVLRFMSDKGELITVAVGVHNYKRWCDVVTGLKPEETALVINPQYYNNGPRAYTREKQLAEYNVTSVVGTRFEVKYTVVEGNNLEANVIFS 143
               SCOP domains d3qdsa_ A: automated matches                                                                                                                    SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeee.hhhhh.eeeeeeee.hhhh.eeeeee..eeeeee.....eeeeeeee....eeeeeeeee..eeeeeee.......hhhhhhhhhh....hhhhhhh...eeeee.....eeeeeeee....eeeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3qds A   0 xTYSITLRVFQRNPGRGFFSIVEKTVFHYANGGTWSEAKGTHTLTMGGSGTSGVLRFMSDKGELITVAVGVHNYKRWCDVVTGLKPEETALVINPQYYNNGPRAYTREKQLAEYNVTSVVGTRFEVKYTVVEGNNLEANVIFS 142
                            |        9        19        29        39        49        59        69        79        89        99       109       119       129       139   
                            |                                                                                                                                              
                            0-ACE                                                                                                                                          


Chain B from PDB  Type:PROTEIN  Length:143
 aligned with BEL_BOLED | F2Z266 from UniProtKB/Swiss-Prot  Length:143

    Alignment length:143
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140   
            BEL_BOLED     1 MTYSITLRVFQRNPGRGFFSIVEKTVFHYANGGTWSEAKGTHTLTMGGSGTSGVLRFMSDKGELITVAVGVHNYKRWCDVVTGLKPEETALVINPQYYNNGPRAYTREKQLAEYNVTSVVGTRFEVKYTVVEGNNLEANVIFS 143
               SCOP domains d3qdsb_ B: automated matches                                                                                                                    SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeee.hhhhh.eeeeeeee......eeeeee..eeeeee.....eeeeeeee....eeeeeeeee..eeeeeee.......hhhhhhhhhh....hhhhhhh...eeeee.....eeeeeeee....eeeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3qds B   0 xTYSITLRVFQRNPGRGFFSIVEKTVFHYANGGTWSEAKGTHTLTMGGSGTSGVLRFMSDKGELITVAVGVHNYKRWCDVVTGLKPEETALVINPQYYNNGPRAYTREKQLAEYNVTSVVGTRFEVKYTVVEGNNLEANVIFS 142
                            |        9        19        29        39        49        59        69        79        89        99       109       119       129       139   
                            0-ACE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3QDS)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3QDS)

(-) Gene Ontology  (1, 1)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (BEL_BOLED | F2Z266)
molecular function
    GO:0030246    carbohydrate binding    Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3qds)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3qds)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3qds
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  BEL_BOLED | F2Z266
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  BEL_BOLED | F2Z266
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        BEL_BOLED | F2Z266: 3qdt 3qdu 3qdv 3qdw 3qdx 3qdy

(-) Related Entries Specified in the PDB File

3qdt 3qdu 3qdv 3qdw 3qdx 3qdy