|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 10)| Asymmetric Unit (2, 10) Biological Unit 1 (2, 20) |
Sites (6, 6)
Asymmetric Unit (6, 6)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3QAO) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3QAO) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3QAO) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3QAO) |
Exons (0, 0)| (no "Exon" information available for 3QAO) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:140 aligned with Q8Y9K1_LISMO | Q8Y9K1 from UniProtKB/TrEMBL Length:246 Alignment length:140 1 | 7 17 27 37 47 57 67 77 87 97 107 117 127 137 Q8Y9K1_LISMO - ---MQIKELAELTGVSVRTLHHYDKIGLLVPQKDDWNGYRIYSEKDVDKLQQILFFKELDFPLKKIQQILDDPLFDKNVALDMQRHLLIEKKQRIETMLATLDLTIKNEKGEITMTNKEKFTGFDFSSNPYEEEARKLWG 137 SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains -------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ----MerR-3qaoA01 A:2-39 ----MerR-DNA-bind-3qaoA02 A:44-104 ----------------------TipAS-3qaoA Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------------------- Transcript 3qao A -2 SNAmQIKELAELTGVSVRTLHHYDKIGLLVPQKDDWNGYRIYSEKDVDKLQQILFFKELDFPLKKIQQILDDPLFDKNVALDmQRHLLIEKKQRIETmLATLDLTIKNEKGEITmTNKEKFTGFDFSSNPYEEEARKLWG 137 | 7 17 27 37 47 57 67 77 | 87 |97 107 | 117 127 137 | 80-MSE 95-MSE 112-MSE 1-MSE
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3QAO) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3QAO) |
Pfam Domains (3, 3)
Asymmetric Unit
|
Gene Ontology (2, 2)|
Asymmetric Unit(hide GO term definitions) Chain A (Q8Y9K1_LISMO | Q8Y9K1)
|
||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|