3Q9U - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   IN SILICO AND IN VITRO CO-EVOLUTION OF A HIGH AFFINITY COMPLEMENTARY PROTEIN-PROTEIN INTERFACE

Authors :   J. Karanicolas, J. E. Corn, I. Chen, L. A. Joachimiak, O. Dym, S. Chung, S T. Unger, W. Hu, G. Liu, S. Delbecq, G. T. Montelione, C. Spiegel, D. Liu Israel Structural Proteomics Center (Ispc)

Date :   10 Jan 11 (Deposition) - 20 Apr 11 (Release) - 20 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.30

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,C  (1x)
Biol. Unit 2: B,D  (1x)

Keywords :   Structural Genomics, Israel Structural Proteomics Center, Ispc, Prb- Binding Designed Ankyrin Repeat, Protein Binding, De Novo Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. Karanicolas, J. E. Corn, I. Chen, L. A. Joachimiak, O. Dym, S. H. Peck S. Albeck, T. Unger, W. Hu, G. Liu, S. Delbecq, G. T. Montelione, C. P. Spiegel, D. R. Liu, D. Baker
A De Novo Protein Binding Pair By Computational Design And Directed Evolution.
Mol. Cell V. 42 250 2011
PubMed-ID: 21458342 | Reference-DOI: 10.1016/J.MOLCEL.2011.03.010

Molecule 1 - COA BINDING PROTEIN
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Organism Scientific	:	ESCHERICHIA COLI
	Organism Taxid	:	562

Molecule 2 - CONSENSUS ANKYRIN REPEAT
	Chains	:	C, D
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Organism Scientific	:	ESCHERICHIA COLI
	Organism Taxid	:	562

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A		C
Biological Unit 2 (1x)	:		B		D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 2)

No.	Name	Count	Type	Full Name
1	COA	2	Ligand/Ion	COENZYME A

Biological Unit 1 (1, 1)

No.	Name	Count	Type	Full Name
1	COA	1	Ligand/Ion	COENZYME A

Biological Unit 2 (1, 1)

No.	Name	Count	Type	Full Name
1	COA	1	Ligand/Ion	COENZYME A

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLY A:26 , SER A:28 , LYS A:30 , ARG A:33 , ASP A:34 , VAL A:52 , ASN A:53 , ASN A:55 , TYR A:56 , VAL A:82 , ASN A:83 , LYS A:86 , PHE A:90 , GLN A:105 , TYR A:106 , CYS A:129 , MET A:131 , ARG A:132 , GLU C:8 , ASN C:45	BINDING SITE FOR RESIDUE COA A 1070
2	AC2	SOFTWARE	VAL B:25 , GLY B:26 , SER B:28 , LYS B:30 , ARG B:33 , ASP B:34 , VAL B:52 , ASN B:53 , PRO B:54 , ASN B:55 , TYR B:56 , PHE B:81 , VAL B:82 , ASN B:83 , LYS B:86 , PHE B:90 , GLN B:105 , TYR B:106 , CYS B:129 , ARG B:132 , GLU D:8 , ALA D:11 , ALA D:12 , ASN D:45	BINDING SITE FOR RESIDUE COA B 1070

(no "SS Bond" information available for 3Q9U)

Asymmetric Unit

No.	Residues
1	Gly A:121	-	Leu A:122
2	Ala D:-3	-	Phe D:-2

(no "SAP(SNP)/Variant" information available for 3Q9U)

(no "PROSITE Motif" information available for 3Q9U)

(no "Exon" information available for 3Q9U)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:138
                                                                                                                                                                          
               SCOP domains d3q9ua_ A: automated matches                                                                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ........hhhhhhhhhhhh.eeeee.......hhhhhhhhhhhh...eeeee.....ee..ee.............eeee..hhhhhhhhhhhhhhhh..eeee.....hhhhh.....eeee..hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3q9u A   0 ATRPIDGLTDEGIRETLTRYKKIALVGASPKPERDANIVMKYLLEHGYDVYPVNPNYEEVLGRKCYPSVLDIPDKIEVVDLFVNPAKAWRFVAYAIKKGAKVVWFQYNTYYPLAARQAGLIIVANRCMMREHKRLLGE 140
                                     9        19        29        39        49        59        69        79        89        99       109       122       132        
                                                                                                                                               117|                   
                                                                                                                                                121

Chain B from PDB  Type:PROTEIN  Length:136
                                                                                                                                                                        
               SCOP domains d3q9ub_ B: automated matches                                                                                                             SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhh.eeeee.......hhhhhhhhhhhh...eeeee.....ee..ee.............eeee.....hhhhhhhhhhh....eeee.....hhhhh....eeee..hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3q9u B   0 ATRPIDGLTDEGIRETLTRYKKIALVGASPKPERDANIVMKYLLEHGYDVYPVNPNYEEVLGRKCYPSVLDIPDKIEVVDLFVNPAKAWRFVAYAIKKGAKVVWFQYNTYYPLAAGAGLIIVANRCMMREHKRLLG 139
                                     9        19        29        39        49        59        69        79        89        99       109    || 123       133      
                                                                                                                                            114|                    
                                                                                                                                             119

Chain C from PDB  Type:PROTEIN  Length:157
                                                                                                                                                                                             
               SCOP domains d3q9uc_ C: automated matches                                                                                                                                  SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhh.............hhhhhhhhh.hhhhhhhhhhh............hhhhhhhhh.hhhhhhhhhhh............hhhhhhhhh.hhhhhhhhhhh............hhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3q9u C  -2 FGQDLGKKLLEAAAAGQDDEVRILMANGADVNATDDNGLTPLHLAAANGQLEIVEVLLKNGADVNASDSAGITPLHLAAYDGHLEIVEVLLKHGADVNAYDRAGWTPLHLAALSGQLEIVEVLLKHGADVNAQDALGLTAFDISINQGQEDLAEILQ 154
                                     7        17        27        37        47        57        67        77        87        97       107       117       127       137       147

Chain D from PDB  Type:PROTEIN  Length:158
                                                                                                                                                                                              
               SCOP domains d3q9ud_ D: automated matches                                                                                                                                   SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhh.hhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhh.............hhhhhhhhh.hhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhh............hhhhhhhhh.hhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3q9u D  -3 AFGQDLGKKLLEAAAAGQDDEVRILMANGADVNATDDNGLTPLHLAAANGQLEIVEVLLKNGADVNASDSAGITPLHLAAYDGHLEIVEVLLKHGADVNAYDRAGWTPLHLAALSGQLEIVEVLLKHGADVNAQDALGLTAFDISINQGQEDLAEILQ 154
                                     6        16        26        36        46        56        66        76        86        96       106       116       126       136       146

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "CATH Domain" information available for 3Q9U)

(no "Pfam Domain" information available for 3Q9U)

Asymmetric Unit(hide GO term definitions)

(no "Gene Ontology" information available for 3Q9U)

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		COA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Ala D:-3 - Phe D:-2	[ RasMol ]
		Gly A:121 - Leu A:122	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3q9u
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	(no 'UniProt ID/Accession number' available) \|
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	(no 'UniProt ID/Accession number' available) \|
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT

(no "Entries Sharing at Least One Protein Chain" available for 3Q9U)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (0, 0)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File