|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 4)| Asymmetric/Biological Unit (2, 4) |
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3Q20) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3Q20) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3Q20) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3Q20) |
Exons (0, 0)| (no "Exon" information available for 3Q20) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:114 aligned with Q8DIS6_THEEB | Q8DIS6 from UniProtKB/TrEMBL Length:126 Alignment length:114 10 20 30 40 50 60 70 80 90 100 110 Q8DIS6_THEEB 1 MDVKHIAKQTTKTLISYLTYQAVRTVIGQLAETDPPRSLWLHQFTSQESIQDGERYLEALFREQPDLGFRILTVREHLAEMVADYLPEMLRAGIQQANLQQRCQQLERMTQVSE 114 SCOP domains d3q20a_ A: automated matches SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------ Transcript 3q20 A 1 MDVKHIAKQTTKTLISYLTYQAVRTVIGQLAETDPPRSLWLHQFTSQESIQDGERYLEALFREQPDLGFRILTVREHLAEMVADYLPEMLRAGIQQANLQQRAQQLERMTQVSE 114 10 20 30 40 50 60 70 80 90 100 110 Chain B from PDB Type:PROTEIN Length:106 aligned with Q8DIS6_THEEB | Q8DIS6 from UniProtKB/TrEMBL Length:126 Alignment length:106 11 21 31 41 51 61 71 81 91 101 Q8DIS6_THEEB 2 DVKHIAKQTTKTLISYLTYQAVRTVIGQLAETDPPRSLWLHQFTSQESIQDGERYLEALFREQPDLGFRILTVREHLAEMVADYLPEMLRAGIQQANLQQRCQQLE 107 SCOP domains d3q20b_ B: automated matches SCOP domains CATH domains ---------------------------------------------------------------------------------------------------------- CATH domains Pfam domains (1) RcbX-3q20B01 B:2-107 Pfam domains (1) Pfam domains (2) RcbX-3q20B02 B:2-107 Pfam domains (2) SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------- Transcript 3q20 B 2 DVKHIAKQTTKTLISYLTYQAVRTVIGQLAETDPPRSLWLHQFTSQESIQDGERYLEALFREQPDLGFRILTVREHLAEMVADYLPEMLRAGIQQANLQQRAQQLE 107 11 21 31 41 51 61 71 81 91 101
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric/Biological Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3Q20) |
Pfam Domains (1, 2)
Asymmetric/Biological Unit
|
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 3Q20)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|