Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF CEL7A FROM TALAROMYCES EMERSONII IN COMPLEX WITH CELLOTETRAOSE
 
Authors :  L. Qin, J. H. Pereira, R. P. Mcandrew, B. A. Simmons, R. Sapra, P. D. Adams
Date :  29 Oct 10  (Deposition) - 02 Nov 11  (Release) - 02 Nov 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.10
Chains :  Asym./Biol. Unit :  A
Keywords :  Cellobiohydrolase, Cellulose, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  L. Qin, J. H. Pereira, R. P. Mcandrew, B. A. Simmons, R. Sapra, P. D. Adams, K. L. Sale
Crystal Structure Of Cel7A From Talaromyces Emersonii In Complex With Cellotetraose
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - CELLOBIOHYDROLASE 1 CATALYTIC DOMAIN
    Chains: A
    EC Number: 3.2.1.91
    Engineered: YES
    Expression System: ASPERGILLUS NIGER
    Expression System Taxid: 5061
    Fragment: UNP RESIDUES 19-455
    Gene: CBH1, CBH1A
    Organism Scientific: TALAROMYCES EMERSONII
    Organism Taxid: 68825
    Synonym: CELLOBIOHYDROLASE I CATALYTIC DOMAIN

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (7, 10)

Asymmetric/Biological Unit (7, 10)
No.NameCountTypeFull Name
1BMA1Ligand/IonBETA-D-MANNOSE
2CBI1Ligand/IonCELLOBIOSE
3CTT1Ligand/IonBETA-D-GLUCOPYRANOSYL-(1->4)-BETA-D-GLUCOPYRANOSYL-(1->4)-BETA-D-GLUCOPYRANOSYL-(1->4)-BETA-D-GLUCOPYRANOSE
4MAN1Ligand/IonALPHA-D-MANNOSE
5NAG3Ligand/IonN-ACETYL-D-GLUCOSAMINE
6PCA1Mod. Amino AcidPYROGLUTAMIC ACID
7SO42Ligand/IonSULFATE ION

(-) Sites  (9, 9)

Asymmetric Unit (9, 9)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETHR A:48 , ASN A:267 , PRO A:317 , NAG A:439 , HOH A:485 , HOH A:774 , HOH A:1020 , HOH A:1036 , HOH A:1138 , HOH A:1172 , HOH A:1180BINDING SITE FOR RESIDUE NAG A 438
2AC2SOFTWAREGLY A:46 , TYR A:60 , NAG A:438 , BMA A:442 , HOH A:558 , HOH A:593 , HOH A:817 , HOH A:877 , HOH A:1105 , HOH A:1138 , HOH A:1264BINDING SITE FOR RESIDUE NAG A 439
3AC3SOFTWARENAG A:439 , MAN A:443 , HOH A:560 , HOH A:717 , HOH A:1259BINDING SITE FOR RESIDUE BMA A 442
4AC4SOFTWAREASN A:45 , TYR A:60 , ASN A:70 , BMA A:442 , HOH A:745 , HOH A:1090 , HOH A:1217 , HOH A:1259 , HOH A:1301BINDING SITE FOR RESIDUE MAN A 443
5AC5SOFTWAREASN A:431 , ALA A:436 , HOH A:479 , HOH A:512 , HOH A:566 , HOH A:761 , HOH A:806 , HOH A:815 , HOH A:845 , HOH A:916 , HOH A:1266 , HOH A:1289BINDING SITE FOR RESIDUE NAG A 440
6AC6SOFTWAREASN A:37 , TRP A:38 , ARG A:39 , TYR A:51 , ASN A:100 , VAL A:101 , ARG A:104 , TYR A:142 , ASP A:176 , LYS A:178 , ASN A:197 , THR A:198 , TYR A:244 , SER A:369 , TRP A:371 , ASP A:372 , HOH A:449 , HOH A:530 , HOH A:550 , HOH A:698 , HOH A:951 , HOH A:957 , HOH A:971 , HOH A:986 , HOH A:1050 , HOH A:1086 , HOH A:1148 , HOH A:1152 , HOH A:1155 , HOH A:1199 , HOH A:1209 , HOH A:1265BINDING SITE FOR RESIDUE CTT A 555
7AC7SOFTWAREILE A:116 , ASP A:147 , ALA A:148 , GLN A:362 , HOH A:500 , HOH A:516 , HOH A:586 , HOH A:970 , HOH A:979BINDING SITE FOR RESIDUE SO4 A 441
8AC8SOFTWAREALA A:8 , THR A:400 , HOH A:888 , HOH A:1061 , HOH A:1162 , HOH A:1176BINDING SITE FOR RESIDUE SO4 A 444
9AC9SOFTWAREGLN A:172 , ASP A:211 , GLU A:214 , HIS A:225 , ARG A:248 , PRO A:255 , ASP A:256 , ARG A:264 , ASP A:343 , TRP A:380 , TYR A:385 , ARG A:398 , HOH A:544 , HOH A:547 , HOH A:582 , HOH A:588 , HOH A:591 , HOH A:628 , HOH A:680 , HOH A:696 , HOH A:875 , HOH A:885 , HOH A:964 , HOH A:965 , HOH A:972 , HOH A:975 , HOH A:1134 , HOH A:1209 , HOH A:1253BINDING SITE FOR RESIDUE CBI A 445

(-) SS Bonds  (9, 9)

Asymmetric/Biological Unit
No.Residues
1A:19 -A:25
2A:50 -A:71
3A:61 -A:67
4A:135 -A:401
5A:169 -A:207
6A:173 -A:206
7A:227 -A:253
8A:235 -A:240
9A:258 -A:334

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Tyr A:385 -Pro A:386

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3PFZ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3PFZ)

(-) Exons   (0, 0)

(no "Exon" information available for 3PFZ)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:436
 aligned with Q8TFL9_TALEM | Q8TFL9 from UniProtKB/TrEMBL  Length:455

    Alignment length:436
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448      
         Q8TFL9_TALEM    19 QQAGTATAENHPPLTWQECTAPGSCTTQNGAVVLDANWRWVHDVNGYTNCYTGNTWDPTYCPDDETCAQNCALDGADYEGTYGVTSSGSSLKLNFVTGSNVGSRLYLLQDDSTYQIFKLLNREFSFDVDVSNLPCGLNGALYFVAMDADGGVSKYPNNKAGAKYGTGYCDSQCPRDLKFIDGEANVEGWQPSSNNANTGIGDHGSCCAEMDVWEANSISNAVTPHPCDTPGQTMCSGDDCGGTYSNDRYAGTCDPDGCDFNPYRMGNTSFYGPGKIIDTTKPFTVVTQFLTDDGTDTGTLSEIKRFYIQNSNVIPQPNSDISGVTGNSITTEFCTAQKQAFGDTDDFSQHGGLAKMGAAMQQGMVLVMSLWDDYAAQMLWLDSDYPTDADPTTPGIARGTCPTDSGVPSDVESQSPNSYVTYSNIKFGPINSTFTA 454
               SCOP domains d3pfza_ A: automated matches                                                                                                                                                                                                                                                                                                                                                                                                                         SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee.........eeeeeeeee..eeeeeeeeeee.hhhh.eee.......ee..ee......hhhhhhhheee...hhhhhhheeee..eeeee.ee..ee.eeeeeeee..ee.ee....eeeeeeee.......eeeeeeee...............hhhhhh.............ee..ee.....ee.......ee..eeee..eeeeeee....eeeeee.......eeee.hhhh.............................ee....ee....eeeeeeeee........eeeeeeeeee..eeee..............hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhheeeeeeeee.....hhhhhh.......................hhhhhhhhh...eeeeeeeeeee....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3pfz A   1 xQAGTATAENHPPLTWQECTAPGSCTTQNGAVVLDANWRWVHDVNGYTNCYTGNTWDPTYCPDDETCAQNCALDGADYEGTYGVTSSGSSLKLNFVTGSNVGSRLYLLQDDSTYQIFKLLNREFSFDVDVSNLPCGLNGALYFVAMDADGGVSKYPNNKAGAKYGTGYCDSQCPRDLKFIDGEANVEGWQPSSNNANTGIGDHGSCCAEMDVWEANSISNAVTPHPCDTPGQTMCSGDDCGGTYSNDRYAGTCDPDGCDFNPYRMGNTSFYGPGKIIDTTKPFTVVTQFLTDDGTDTGTLSEIKRFYIQNSNVIPQPNSDISGVTGNSITTEFCTAQKQAFGDTDDFSQHGGLAKMGAAMQQGMVLVMSLWDDYAAQMLWLDSDYPTDADPTTPGIARGTCPTDSGVPSDVESQSPNSYVTYSNIKFGPINSTFTA 436
                            |       10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430      
                            |                                                                                                                                                                                                                                                                                                                                                                                                                                                   
                            1-PCA
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3PFZ)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3PFZ)

(-) Gene Ontology  (7, 7)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (Q8TFL9_TALEM | Q8TFL9)
molecular function
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0016798    hydrolase activity, acting on glycosyl bonds    Catalysis of the hydrolysis of any glycosyl bond.
    GO:0004553    hydrolase activity, hydrolyzing O-glycosyl compounds    Catalysis of the hydrolysis of any O-glycosyl bond.
biological process
    GO:0005975    carbohydrate metabolic process    The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
    GO:0030245    cellulose catabolic process    The chemical reactions and pathways resulting in the breakdown of cellulose, a linear beta1-4 glucan of molecular mass 50-400 kDa with the pyranose units in the -4C1 conformation.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
    GO:0000272    polysaccharide catabolic process    The chemical reactions and pathways resulting in the breakdown of a polysaccharide, a polymer of many (typically more than 10) monosaccharide residues linked glycosidically.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BMA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CBI  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    CTT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MAN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PCA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Tyr A:385 - Pro A:386   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3pfz
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8TFL9_TALEM | Q8TFL9
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  3.2.1.91
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q8TFL9_TALEM | Q8TFL9
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q8TFL9_TALEM | Q8TFL9: 1q9h 3pfj 3pfx 3pl3

(-) Related Entries Specified in the PDB File

3pfj 3pfx