Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PDUT A TRIMERIC BACTERIAL MICROCOMPARTMENT PROTEIN WITH 4FE-4S CLUSTER BINDING SITE
 
Authors :  A. H. Pang, M. J. Warren, R. W. Pickersgill
Date :  19 Oct 10  (Deposition) - 01 Dec 10  (Release) - 09 Feb 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.86
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (3x)
Keywords :  Bmc Domain, Shell Protein, Electron Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Pang, M. J. Warren, R. W. Pickersgill
Structure Of Pdut, A Trimeric Bacterial Microcompartment Protein With A 4Fe-4S Cluster-Binding Site
Acta Crystallogr. , Sect. D V. 67 91 2011
PubMed-ID: 21245529  |  Reference-DOI: 10.1107/S0907444910050201

(-) Compounds

Molecule 1 - SHELL PROTEIN
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET14B
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: PDUT
    Organism Scientific: CITROBACTER FREUNDII
    Organism Taxid: 546
    Synonym: PDUT MICROCOMPARTMENT SHELL PROTEIN

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (3x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3PAC)

(-) Sites  (0, 0)

(no "Site" information available for 3PAC)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3PAC)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3PAC)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3PAC)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3PAC)

(-) Exons   (0, 0)

(no "Exon" information available for 3PAC)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:183
 aligned with B1VB78_CITFR | B1VB78 from UniProtKB/TrEMBL  Length:184

    Alignment length:183
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181   
         B1VB78_CITFR     2 SQAIGILELTSIAKGMEAGDAMLKSANVNLLVSKTICPGKFLLMLGGDVGAVQQAIATGTSLAGDMLVDSLVLPNIHASVLPAISGLNSVDKRQAVGIVETWSVAACICAADRAVKASNVTLVRVHMAFGIGGKCYMVVAGDVSDVNNAVTVASESAGEKGLLVYRSVIPRPHESMWRQMVEG 184
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ---------------------------------------------------------------------------------------------BMC-3pacA01 A:95-173                                                           ----------- Pfam domains (1)
           Pfam domains (2) ---------------------------------------------------------------------------------------------BMC-3pacA02 A:95-173                                                           ----------- Pfam domains (2)
         Sec.struct. author .eeeeeeee.hhhhhhhhhhhhhhhh..eeeeeeee...eeeeeeeehhhhhhhhhhhhhhhhh..eeeeeeeeee..hhhhhhhh........eeeeeeeehhhhhhhhhhhhhhhh..eeeeeee......eeeeeeeehhhhhhhhhhhhhhhhhhh..eeeeeeee..hhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3pac A   2 SQAIGILELTSIAKGMEAGDAMLKSANVNLLVSKTICPGKFLLMLGGDVGAVQQAIATGTSLAGDMLVDSLVLPNIHASVLPAISGLNSVDKRQAVGIVETWSVAACICAADRAVKASNVTLVRVHMAFGIGGKCYMVVAGDVSDVNNAVTVASESAGEKGLLVYRSVIPRPHESMWRQMVEG 184
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3PAC)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3PAC)

(-) Pfam Domains  (1, 2)

Asymmetric Unit
(-)
Clan: no clan defined [family: BMC] (7)
(-)
Family: BMC (7)
(-)
Citrobacter freundii (1)
1aBMC-3pacA01A:95-173
1bBMC-3pacA02A:95-173

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 3PAC)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3pac)
 
  Sites
(no "Sites" information available for 3pac)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3pac)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3pac
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  B1VB78_CITFR | B1VB78
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  B1VB78_CITFR | B1VB78
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3PAC)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3PAC)