Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  DHPI-SAM-HEP COMPLEX
 
Authors :  B. Bae, S. K. Nair
Date :  14 Sep 10  (Deposition) - 27 Oct 10  (Release) - 27 Oct 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,D  (1x)
Biol. Unit 2:  B,C  (1x)
Biol. Unit 3:  A,B,C,D  (2x)
Keywords :  O-Methyltransferase, Sam, Hydroxyethylphosphonic Acid, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. H. Lee, B. Bae, M. Kuemin, B. T. Circello, W. W. Metcalf, S. K. Nair, W. A. Van Der Donk
Characterization And Structure Of Dhpi, A Phosphonate O-Methyltransferase Involved In Dehydrophos Biosynthesis.
Proc. Natl. Acad. Sci. Usa V. 107 17557 2010
PubMed-ID: 20876132  |  Reference-DOI: 10.1073/PNAS.1006848107

(-) Compounds

Molecule 1 - SAM-DEPENDENT METHYLTRANSFERASE
    ChainsA, B, C, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21(DE3)
    Expression System Taxid562
    Expression System Vector TypePET-28
    GeneDHPI
    Organism ScientificSTREPTOMYCES LURIDUS
    Organism Taxid67320

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)A  D
Biological Unit 2 (1x) BC 
Biological Unit 3 (2x)ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 8)

Asymmetric Unit (3, 8)
No.NameCountTypeFull Name
12HE1Ligand/Ion(2-HYDROXYETHYL)PHOSPHONIC ACID
2SAM4Ligand/IonS-ADENOSYLMETHIONINE
3SO43Ligand/IonSULFATE ION
Biological Unit 1 (3, 4)
No.NameCountTypeFull Name
12HE1Ligand/Ion(2-HYDROXYETHYL)PHOSPHONIC ACID
2SAM2Ligand/IonS-ADENOSYLMETHIONINE
3SO41Ligand/IonSULFATE ION
Biological Unit 2 (2, 4)
No.NameCountTypeFull Name
12HE-1Ligand/Ion(2-HYDROXYETHYL)PHOSPHONIC ACID
2SAM2Ligand/IonS-ADENOSYLMETHIONINE
3SO42Ligand/IonSULFATE ION
Biological Unit 3 (3, 16)
No.NameCountTypeFull Name
12HE2Ligand/Ion(2-HYDROXYETHYL)PHOSPHONIC ACID
2SAM8Ligand/IonS-ADENOSYLMETHIONINE
3SO46Ligand/IonSULFATE ION

(-) Sites  (8, 8)

Asymmetric Unit (8, 8)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETYR A:15 , TYR A:22 , PHE A:26 , ALA A:54 , SER A:55 , GLY A:56 , ASP A:75 , GLY A:76 , SER A:77 , MET A:80 , GLN A:97 , ASP A:98 , LEU A:99 , PHE A:100 , ALA A:114 , HIS A:115 , TRP A:116 , HIS A:119 , HOH A:221 , HOH A:265 , SO4 A:301BINDING SITE FOR RESIDUE SAM A 300
2AC2SOFTWARETYR A:15 , ARG A:18 , HIS A:119 , ARG A:168 , LYS A:180 , SAM A:300 , HOH A:376 , HOH D:377BINDING SITE FOR RESIDUE SO4 A 301
3AC3SOFTWARETYR B:15 , TYR B:22 , PHE B:26 , ALA B:54 , SER B:55 , GLY B:56 , TRP B:60 , ASP B:75 , GLY B:76 , SER B:77 , MET B:80 , GLN B:97 , ASP B:98 , LEU B:99 , PHE B:100 , ALA B:114 , HIS B:115 , TRP B:116 , HIS B:119 , HOH B:251 , HOH B:261 , HOH B:267 , SO4 B:301BINDING SITE FOR RESIDUE SAM B 300
4AC4SOFTWARETYR B:15 , ARG B:18 , HIS B:119 , ARG B:168 , LYS B:180 , SAM B:300 , HOH B:380BINDING SITE FOR RESIDUE SO4 B 301
5AC5SOFTWARETYR C:15 , TYR C:22 , PHE C:26 , ALA C:54 , SER C:55 , GLY C:56 , TRP C:60 , ASP C:75 , GLY C:76 , SER C:77 , MET C:80 , GLN C:97 , ASP C:98 , LEU C:99 , PHE C:100 , ALA C:114 , HIS C:115 , TRP C:116 , HOH C:224 , HOH C:242 , HOH C:275 , HOH C:280 , SO4 C:301BINDING SITE FOR RESIDUE SAM C 300
6AC6SOFTWARETYR C:15 , ARG C:18 , HIS C:119 , ARG C:168 , LYS C:180 , HOH C:248 , SAM C:300 , HOH C:382BINDING SITE FOR RESIDUE SO4 C 301
7AC7SOFTWARETYR D:15 , TYR D:22 , ALA D:54 , GLY D:56 , ASP D:75 , GLY D:76 , SER D:77 , MET D:80 , GLN D:97 , ASP D:98 , LEU D:99 , PHE D:100 , ALA D:114 , HIS D:115 , TRP D:116 , HIS D:119 , HOH D:232BINDING SITE FOR RESIDUE SAM D 300
8AC8SOFTWAREHOH A:253 , TYR D:15 , ARG D:18 , PHE D:26 , VAL D:27 , PRO D:28 , HIS D:119 , ARG D:168 , LYS D:180BINDING SITE FOR RESIDUE 2HE D 301

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3OU7)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3OU7)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3OU7)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3OU7)

(-) Exons   (0, 0)

(no "Exon" information available for 3OU7)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:214
 aligned with D7PC21_9ACTN | D7PC21 from UniProtKB/TrEMBL  Length:218

    Alignment length:214
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211    
         D7PC21_9ACTN     2 TTSHGLIESQLSYYRARASEYDATFVPYMDSAAPAALERLRAGNIRGDVLELASGTGYWTRHLSGLADRVTALDGSAEMIAEAGRHGLDNVEFRQQDLFDWTPDRQWDAVFFAHWLAHVPDDRFEAFWESVRSAVAPGGVVEFVDVTDHERRLEQQDDSEPEVAVRRTLQDGRSFRIVKVFRSPAELTERLTALGWSCSVDEVHPGFLYATCRP 215
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh......eeeee....hhhhhhhhhhh.eeeeee.hhhhhhhhhh.....eeeee...........eeeeeee.hhhhhhhhhhhhhhhhhhhheeeeeeeeeeee....hhhhhhh......eeeee.....eeeee....hhhhhhhhhhhh..eeeeeeee..eeeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3ou7 A   2 TTSHGLIESQLSYYRARASEYDATFVPYMDSAAPAALERLRAGNIRGDVLELASGTGYWTRHLSGLADRVTALDGSAEMIAEAGRHGLDNVEFRQQDLFDWTPDRQWDAVFFAHWLAHVPDDRFEAFWESVRSAVAPGGVVEFVDVTDHERRLEQQDDSEPEVAVRRTLQDGRSFRIVKVFRSPAELTERLTALGWSCSVDEVHPGFLYATCRP 215
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211    

Chain B from PDB  Type:PROTEIN  Length:214
 aligned with D7PC21_9ACTN | D7PC21 from UniProtKB/TrEMBL  Length:218

    Alignment length:214
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214    
         D7PC21_9ACTN     5 HGLIESQLSYYRARASEYDATFVPYMDSAAPAALERLRAGNIRGDVLELASGTGYWTRHLSGLADRVTALDGSAEMIAEAGRHGLDNVEFRQQDLFDWTPDRQWDAVFFAHWLAHVPDDRFEAFWESVRSAVAPGGVVEFVDVTDHERRLEQQDDSEPEVAVRRTLQDGRSFRIVKVFRSPAELTERLTALGWSCSVDEVHPGFLYATCRPGPR 218
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh......eeeee....hhhhhhhhhhh.eeeeee.hhhhhhhhhh.....eeeee...........eeeeeee.hhhhhhhhhhhhhhhhhhhheeeeeeeeeeee....hhhhhhh......eeeee.....eeeee....hhhhhhhhhhh...eeeeeeee..eeeeeee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3ou7 B   5 HGLIESQLSYYRARASEYDATFVPYMDSAAPAALERLRAGNIRGDVLELASGTGYWTRHLSGLADRVTALDGSAEMIAEAGRHGLDNVEFRQQDLFDWTPDRQWDAVFFAHWLAHVPDDRFEAFWESVRSAVAPGGVVEFVDVTDHERRLEQQDDSEPEVAVRRTLQDGRSFRIVKVFRSPAELTERLTALGWSCSVDEVHPGFLYATCRPGPR 218
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214    

Chain C from PDB  Type:PROTEIN  Length:212
 aligned with D7PC21_9ACTN | D7PC21 from UniProtKB/TrEMBL  Length:218

    Alignment length:212
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213  
         D7PC21_9ACTN     4 SHGLIESQLSYYRARASEYDATFVPYMDSAAPAALERLRAGNIRGDVLELASGTGYWTRHLSGLADRVTALDGSAEMIAEAGRHGLDNVEFRQQDLFDWTPDRQWDAVFFAHWLAHVPDDRFEAFWESVRSAVAPGGVVEFVDVTDHERRLEQQDDSEPEVAVRRTLQDGRSFRIVKVFRSPAELTERLTALGWSCSVDEVHPGFLYATCRP 215
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhh.hhhhhh..hhhhhhhhhhhhhh......eeeee....hhhhhhhhhhh.eeeeee.hhhhhhhhhh.....eeeee...........eeeeeee.hhhhhhhhhhhhhhhhhhhheeeeeeeeeeee....hhhhhhh......eeeee.....eeeee....hhhhhhhhhhhh..eeeeeeee..eeeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3ou7 C   4 SHGLIESQLSYYRARASEYDATFVPYMDSAAPAALERLRAGNIRGDVLELASGTGYWTRHLSGLADRVTALDGSAEMIAEAGRHGLDNVEFRQQDLFDWTPDRQWDAVFFAHWLAHVPDDRFEAFWESVRSAVAPGGVVEFVDVTDHERRLEQQDDSEPEVAVRRTLQDGRSFRIVKVFRSPAELTERLTALGWSCSVDEVHPGFLYATCRP 215
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213  

Chain D from PDB  Type:PROTEIN  Length:213
 aligned with D7PC21_9ACTN | D7PC21 from UniProtKB/TrEMBL  Length:218

    Alignment length:213
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212   
         D7PC21_9ACTN     3 TSHGLIESQLSYYRARASEYDATFVPYMDSAAPAALERLRAGNIRGDVLELASGTGYWTRHLSGLADRVTALDGSAEMIAEAGRHGLDNVEFRQQDLFDWTPDRQWDAVFFAHWLAHVPDDRFEAFWESVRSAVAPGGVVEFVDVTDHERRLEQQDDSEPEVAVRRTLQDGRSFRIVKVFRSPAELTERLTALGWSCSVDEVHPGFLYATCRP 215
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhh......eeeee....hhhhhhhhhhh.eeeeee.hhhhhhhhhh.....eeeee...........eeeeeee.hhhhhhhhhhhhhhhhhhhheeeeeeeeeeee....hhhhhhh......eeeee.....eeeee....hhhhhhhhhhh...eeeeeeee..eeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3ou7 D   3 TSHGLIESQLSYYRARASEYDATFVPYMDSAAPAALERLRAGNIRGDVLELASGTGYWTRHLSGLADRVTALDGSAEMIAEAGRHGLDNVEFRQQDLFDWTPDRQWDAVFFAHWLAHVPDDRFEAFWESVRSAVAPGGVVEFVDVTDHERRLEQQDDSEPEVAVRRTLQDGRSFRIVKVFRSPAELTERLTALGWSCSVDEVHPGFLYATCRP 215
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3OU7)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3OU7)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3OU7)

(-) Gene Ontology  (6, 6)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (D7PC21_9ACTN | D7PC21)
molecular function
    GO:0051539    4 iron, 4 sulfur cluster binding    Interacting selectively and non-covalently with a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands.
    GO:0051536    iron-sulfur cluster binding    Interacting selectively and non-covalently with an iron-sulfur cluster, a combination of iron and sulfur atoms.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0008168    methyltransferase activity    Catalysis of the transfer of a methyl group to an acceptor molecule.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0032259    methylation    The process in which a methyl group is covalently attached to a molecule.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    2HE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SAM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3ou7)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3ou7
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  D7PC21_9ACTN | D7PC21
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  D7PC21_9ACTN | D7PC21
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        D7PC21_9ACTN | D7PC213ou2 3ou6

(-) Related Entries Specified in the PDB File

3ou2 DHPI-SAH COMPLEX STRUCTURE
3ou6 DHPI-SAM COMPLEX