|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| Asymmetric/Biological Unit (2, 2) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (7, 7)
Asymmetric/Biological Unit
|
||||||||||||||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3OSH) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3OSH) |
PROSITE Motifs (2, 2)
Asymmetric/Biological Unit (2, 2)
|
||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 3OSH) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:119 aligned with PA2A3_NAJSG | P60045 from UniProtKB/Swiss-Prot Length:126 Alignment length:119 17 27 37 47 57 67 77 87 97 107 117 PA2A3_NAJSG 8 NLYQFKNMIQCTVPSRSWQDFADYGCYCGKGGSGTPVDDLDRCCQVHDNCYNEAENISGCRPYFKTYSYECTQGTLTCKGDNNACAASVCDCDRLAAICFAGAPYNDANYNIDLKARCN 126 SCOP domains d3osha_ A: Snake phospholipase A2 SCOP domains CATH domains ----------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------PA2_HIS --------------------------------------PA2_ASP -------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript 3osh A 1 NLYQFKNMIQCTVPSRSWADFADYGCYCGKGGSGTPVDDLDRCCQTHDNCYNEAENISGCRPYFKTYSYECTQGTLTCKGDNNACAASVCDCDRLAAICFAGAPYNDANYNIDLKARCN 120 10 || 21 31 41 51 61 71 81 91 101 111 15| 17
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 3OSH) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3OSH) |
Gene Ontology (7, 7)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (PA2A3_NAJSG | P60045)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|