3OR1 - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF DISSIMILATORY SULFITE REDUCTASE I (DSRI)

Authors :   Y. C. Hsieh, M. Y. Liu, V. C. C. Wang, Y. L. Chiang, E. H. Liu, W. G. Wu, S. I. C C. J. Chen

Date :   06 Sep 10 (Deposition) - 22 Sep 10 (Release) - 22 Sep 10 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.76

Chains :   Asym./Biol. Unit : A,B,C,D,E,F

Keywords :   Dissimilatory Sulfite Reductase, Sulfate Reduction, Oxidoreductase, Sulfite Reduction (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Y. C. Hsieh, M. Y. Liu, V. C. C. Wang, Y. L. Chiang, E. H. Liu, W. G. Wu, S. I. Chan, C. J. Chen
Structure Insights Into The Enzyme Catalysis From Compariso Of Three Forms Of Dissimilatory Sulfite Reductase From Desulfovibrio Gigas
To Be Published
PubMed: search

Molecule 1 - SULFITE REDUCTASE ALPHA
	Chains	:	A, D
	Organism Scientific	:	DESULFOVIBRIO GIGAS
	Organism Taxid	:	879

Molecule 2 - SULFITE REDUCTASE BETA
	Chains	:	B, E
	Organism Scientific	:	DESULFOVIBRIO GIGAS
	Organism Taxid	:	879

Molecule 3 - SULFITE REDUCTASE GAMA
	Chains	:	C, F
	Organism Scientific	:	DESULFOVIBRIO GIGAS
	Organism Taxid	:	879

		1	2	3	4	5	6
Asymmetric/Biological Unit	:	A	B	C	D	E	F

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (3, 14)

No.	Name	Count	Type	Full Name
1	SF4	8	Ligand/Ion	IRON/SULFUR CLUSTER
2	SO3	2	Ligand/Ion	SULFITE ION
3	SRM	4	Ligand/Ion	SIROHEME

Asymmetric Unit (14, 14)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	ARG A:101 , ARG A:172 , LYS A:213 , LYS A:215 , SRM A:580	BINDING SITE FOR RESIDUE SO3 A 6575
02	AC2	SOFTWARE	ARG A:83 , ARG A:101 , GLY A:134 , SER A:135 , THR A:136 , GLY A:137 , ASP A:138 , TYR A:212 , LYS A:213 , LYS A:215 , LYS A:217 , ARG A:231 , LYS A:332 , ALA A:333 , VAL A:335 , ARG A:376 , ARG A:378 , SO3 A:6575 , HOH A:6707 , HOH A:6708 , HOH A:6713 , ARG B:71 , THR B:145 , GLN B:146 , TYR B:150 , CYS B:151 , HIS B:152 , ASN B:191 , CYS B:193 , GLY B:194 , SF4 B:801 , HOH B:808 , HOH B:844 , GLY C:103 , CYS C:104	BINDING SITE FOR RESIDUE SRM A 580
03	AC3	SOFTWARE	CYS A:284 , MET A:289 , CYS A:303 , THR A:304 , ARG A:305 , CYS A:306 , MET A:307 , CYS A:309	BINDING SITE FOR RESIDUE SF4 A 803
04	AC4	SOFTWARE	CYS A:177 , CYS A:183 , PHE A:185 , ALA A:186 , GLY A:220 , CYS A:221 , CYS A:225 , SRM B:581	BINDING SITE FOR RESIDUE SF4 A 804
05	AC5	SOFTWARE	CYS A:177 , LEU A:178 , ARG A:182 , CYS A:183 , GLU A:184 , PHE A:185 , ASN A:223 , GLY A:224 , CYS A:225 , ASN A:262 , ASN A:311 , SF4 A:804 , HOH A:6687 , HIS B:44 , HIS B:54 , ARG B:66 , ARG B:94 , THR B:96 , THR B:97 , ARG B:98 , ASN B:100 , GLU B:102 , GLY B:134 , THR B:135 , GLY B:136 , SER B:140 , ARG B:183 , LYS B:288 , ILE B:289 , SER B:290 , ARG B:292 , ARG B:336 , HOH B:810 , HOH B:816 , HOH B:826 , HOH B:859 , HOH B:862 , HOH B:864 , HOH B:879 , HOH B:902 , HOH B:6739	BINDING SITE FOR RESIDUE SRM B 581
06	AC6	SOFTWARE	SRM A:580 , CYS B:151 , THR B:153 , PRO B:154 , CYS B:188 , CYS B:189 , ASN B:191 , CYS B:193	BINDING SITE FOR RESIDUE SF4 B 801
07	AC7	SOFTWARE	CYS B:231 , THR B:233 , VAL B:236 , CYS B:258 , MET B:259 , CYS B:261 , GLY B:262 , CYS B:264	BINDING SITE FOR RESIDUE SF4 B 802
08	AC8	SOFTWARE	ARG D:101 , ARG D:172 , LYS D:213 , LYS D:215 , SRM D:582 , HOH D:6726 , CYS F:104	BINDING SITE FOR RESIDUE SO3 D 6576
09	AC9	SOFTWARE	ARG D:83 , ARG D:101 , GLY D:134 , SER D:135 , THR D:136 , GLY D:137 , ASP D:138 , TYR D:212 , LYS D:213 , LYS D:215 , LYS D:217 , ARG D:231 , LYS D:332 , ALA D:333 , VAL D:335 , ARG D:376 , ARG D:378 , SO3 D:6576 , HOH D:6598 , HOH D:6646 , HOH D:6690 , HOH D:6711 , ARG E:71 , HIS E:144 , THR E:145 , GLN E:146 , TYR E:150 , CYS E:151 , HIS E:152 , ASN E:191 , CYS E:193 , GLY E:194 , SF4 E:805 , HOH E:824 , HOH E:857 , GLY F:103 , CYS F:104	BINDING SITE FOR RESIDUE SRM D 582
10	BC1	SOFTWARE	CYS D:284 , CYS D:288 , CYS D:303 , THR D:304 , ARG D:305 , CYS D:306 , MET D:307 , CYS D:309	BINDING SITE FOR RESIDUE SF4 D 807
11	BC2	SOFTWARE	CYS D:177 , CYS D:183 , PHE D:185 , ALA D:186 , GLY D:220 , CYS D:221 , ASN D:223 , CYS D:225 , SRM E:583	BINDING SITE FOR RESIDUE SF4 D 808
12	BC3	SOFTWARE	CYS D:177 , LEU D:178 , ARG D:182 , CYS D:183 , GLU D:184 , PHE D:185 , ASN D:223 , GLY D:224 , CYS D:225 , ASN D:262 , ASN D:311 , SF4 D:808 , HOH D:6583 , HOH D:6606 , HOH D:6752 , HIS E:44 , HIS E:54 , ARG E:66 , ARG E:94 , THR E:96 , THR E:97 , ARG E:98 , ASN E:100 , GLU E:102 , GLY E:134 , THR E:135 , GLY E:136 , SER E:140 , ARG E:183 , LYS E:288 , ILE E:289 , SER E:290 , ARG E:292 , ARG E:336 , HOH E:819 , HOH E:822 , HOH E:825 , HOH E:827 , HOH E:830 , HOH E:843 , HOH E:859 , HOH E:888 , HOH E:895 , HOH E:961 , HOH E:6797	BINDING SITE FOR RESIDUE SRM E 583
13	BC4	SOFTWARE	SRM D:582 , THR E:145 , GLN E:146 , CYS E:151 , THR E:153 , PRO E:154 , CYS E:188 , CYS E:189 , ASN E:191 , CYS E:193	BINDING SITE FOR RESIDUE SF4 E 805
14	BC5	SOFTWARE	CYS E:231 , THR E:233 , VAL E:236 , CYS E:258 , MET E:259 , TYR E:260 , CYS E:261 , GLY E:262 , CYS E:264	BINDING SITE FOR RESIDUE SF4 E 806

Asymmetric/Biological Unit

No.	Residues
1	B:222	-	B:268
2	E:222	-	E:268

Asymmetric/Biological Unit

No.	Residues
1	Met A:132	-	His A:133
2	Val A:335	-	Leu A:336
3	Glu A:353	-	Pro A:354
4	Pro B:310	-	Pro B:311
5	Lys D:3	-	His D:4
6	Met D:132	-	His D:133
7	Val D:335	-	Leu D:336
8	Glu D:353	-	Pro D:354
9	Pro E:310	-	Pro E:311

(no "SAP(SNP)/Variant" information available for 3OR1)

(no "PROSITE Motif" information available for 3OR1)

(no "Exon" information available for 3OR1)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:435
 aligned with E2QR97_DESGI | E2QR97 from UniProtKB/TrEMBL  Length:437

    Alignment length:435
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432     
         E2QR97_DESGI     3 KHPTPMLDELEKGPWPSFVSDIKQECDNRAKNPKGLDYQIPAECPDDLLGILELSFHEGETHWKHGGIVGVFGYGGGVIGRYCDQPEMFPGVAHFHTVRLAQPAAKYYTAEYLEAICDVWDLRGSGLTNMHGSTGDIVLLGTQTPQLEEIFFEMTHNLNTDLGGSGSNLRTPESCLGISRCEFACYDTQLMCYQLTQDYQDELHRPAFPYKFKFKFDGCPNGCVASMARSDFAVIGTWKDDIKIDQEAVKAYVGGEFKPNAGAHAGRDWGKFDIEAEVVGLCPTGCMTYESGTLSIDNKNCTRCMHCINTMPRALKIGDERGASILVGAKAPVLDGAQMGSLLIPFIAAEEPFDEVKEVIENIWEWWMEEGKNRERLGETMKRVGFQKLLEVTGTKAVPQHVSEPRHNPYIFFKEEEVPGGWSRDISDYRKRHMR 437
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhh....hhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhh..................ee.........hhhhh...eeee..hhh.eeehhhhhhhhhhhhhhh..eee.......eeee..hhhhhhhhhhhhhhhh..............ee.hhhhh......hhhhhhhhhhhhhhhhhhh........eeee.......hhhhhh.eeeeeee....eehhhhhhhhhh...hhhhhh.........hhhhhh........eeee..eeee.hhhh...hhhhhhh...ee....eeeeeee.............eeeeeee.....hhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh....hhhhh...........hhhhh......hhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3or1 A   3 KHPTPMLDELEKGPWPSFVSDIKQECDNRAKNPKGLDYQIPAECPDDLLGILELSFHEGETHWKHGGIVGVFGYGGGVIGRYCDQPEMFPGVAHFHTVRLAQPAAKYYTAEYLEAICDVWDLRGSGLTNMHGSTGDIVLLGTQTPQLEEIFFEMTHNLNTDLGGSGSNLRTPESCLGISRCEFACYDTQLMCYQLTQDYQDELHRPAFPYKFKFKFDGCPNGCVASMARSDFAVIGTWKDDIKIDQEAVKAYVGGEFKPNAGAHAGRDWGKFDIEAEVVGLCPTGCMTYESGTLSIDNKNCTRCMHCINTMPRALKIGDERGASILVGAKAPVLDGAQMGSLLIPFIAAEEPFDEVKEVIENIWEWWMEEGKNRERLGETMKRVGFQKLLEVTGTKAVPQHVSEPRHNPYIFFKEEEVPGGWSRDISDYRKRHMR 437
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432

Chain B from PDB  Type:PROTEIN  Length:385
 aligned with E2QR96_DESGI | E2QR96 from UniProtKB/TrEMBL  Length:386

    Alignment length:385
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381     
         E2QR96_DESGI     2 AFISSGYNPAKPMENRITDIGPRKFTEFFPPVIAKNAGNWDYHEILEPGILVHVAKNGDKVFTVRCGAARLMSTSHIREACEIAKKFCNGHLRFTTRNNIEFMVDNEETLKALVADLKTRKFAAGSFKFPIGGTGASISNIVHTQGWVYCHTPATDASGPVKAVMDELFEEFTSMRLPAIVRVSLACCINMCGAVHCSDIGLVGIHRKPPMIDHENLAELCEIPLAVAACPTAAVKPITAEVNGQKVKSVAINNDRCMYCGNCYTMCPALPLSDGTGDGIAIMVGGKISNRIKVPSFSKVVVAFVPNEPPRWPTMAKIVKKIVEVYAEDARKYERIGDWIHRIGWETFYEKTGLEFSHHCIDDFRDPAYYTWRQSTQFKFVSFDS 386
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......................hhhhhhhhhhhhhh..eeeeeeee..eeeeee....eeeeeee....eeehhhhhhhhhhhhhhh..eeee.....eeeee.hhhhhhhhhhhhh..........................hhhhh.......hhhhhhhhhhhhhhhhh.........eeee.......hhhhh.eeeeee..........hhhhhhhhhhhhhhh....eeeeeeee..eeeeeeee........hhhhhhh...........eeeeee..............eeeeeeee.....hhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh...hhhhh...hhhhhhhh........hhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3or1 B   2 AFISSGYNPAKPMENRITDIGPRKFTEFFPPVIAKNAGNWDYHEILEPGILVHVAKNGDKVFTVRCGAARLMSTSHIREACEIAKKFCNGHLRFTTRNNIEFMVDNEETLKALVADLKTRKFAAGSFKFPIGGTGASISNIVHTQGWVYCHTPATDASGPVKAVMDELFEEFTSMRLPAIVRVSLACCINMCGAVHCSDIGLVGIHRKPPMIDHENLAELCEIPLAVAACPTAAVKPITAEVNGQKVKSVAINNDRCMYCGNCYTMCPALPLSDGTGDGIAIMVGGKISNRIKVPSFSKVVVAFVPNEPPRWPTMAKIVKKIVEVYAEDARKYERIGDWIHRIGWETFYEKTGLEFSHHCIDDFRDPAYYTWRQSTQFKFVSFDS 386
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381

Chain C from PDB  Type:PROTEIN  Length:104
 aligned with E2QR98_DESGI | E2QR98 from UniProtKB/TrEMBL  Length:105

    Alignment length:104
                                    11        21        31        41        51        61        71        81        91       101    
         E2QR98_DESGI     2 AVVEFAGSAFEVDEDGFLNAFDDWCPEWVKYAKGSEGIGAGSADHQKIIDFLQDYYKANGIAPMVRILSKNTGFALKEIYELFPSGPGKGACKMAGLPKPTGCV 105
               SCOP domains d3or1c_ C: automated matches                                                                             SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee..eeee........hhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh...hhhhhhhhhh.hhhhhhhhh......hhhhhhh........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------- Transcript
                 3or1 C   2 AVVEFAGSAFEVDEDGFLNAFDDWCPEWVKYAKGSEGIGAGSADHQKIIDFLQDYYKANGIAPMVRILSKNTGFALKEIYELFPSGPGKGACKMAGLPKPTGCV 105
                                    11        21        31        41        51        61        71        81        91       101

Chain D from PDB  Type:PROTEIN  Length:435
 aligned with E2QR97_DESGI | E2QR97 from UniProtKB/TrEMBL  Length:437

    Alignment length:435
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432     
         E2QR97_DESGI     3 KHPTPMLDELEKGPWPSFVSDIKQECDNRAKNPKGLDYQIPAECPDDLLGILELSFHEGETHWKHGGIVGVFGYGGGVIGRYCDQPEMFPGVAHFHTVRLAQPAAKYYTAEYLEAICDVWDLRGSGLTNMHGSTGDIVLLGTQTPQLEEIFFEMTHNLNTDLGGSGSNLRTPESCLGISRCEFACYDTQLMCYQLTQDYQDELHRPAFPYKFKFKFDGCPNGCVASMARSDFAVIGTWKDDIKIDQEAVKAYVGGEFKPNAGAHAGRDWGKFDIEAEVVGLCPTGCMTYESGTLSIDNKNCTRCMHCINTMPRALKIGDERGASILVGAKAPVLDGAQMGSLLIPFIAAEEPFDEVKEVIENIWEWWMEEGKNRERLGETMKRVGFQKLLEVTGTKAVPQHVSEPRHNPYIFFKEEEVPGGWSRDISDYRKRHMR 437
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhh....hhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhh..................ee.........hhhhh...eeee..hhh.eeehhhhhhhhhhhhhhh..eee.......eeee....hhhhhhhhhhhhhh..............ee.hhhhh......hhhhhhhhhhhhhhhhhhh........eeee.......hhhhhh.eeeeeee....eehhhhhhhhhh...hhhhhh.........hhhhhh........eeee..eeee.hhhh...hhhhhhh...ee....eeeeeee.............eeeeeee.....hhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh....hhhhh...........hhhhh......hhhhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3or1 D   3 KHPTPMLDELEKGPWPSFVSDIKQECDNRAKNPKGLDYQIPAECPDDLLGILELSFHEGETHWKHGGIVGVFGYGGGVIGRYCDQPEMFPGVAHFHTVRLAQPAAKYYTAEYLEAICDVWDLRGSGLTNMHGSTGDIVLLGTQTPQLEEIFFEMTHNLNTDLGGSGSNLRTPESCLGISRCEFACYDTQLMCYQLTQDYQDELHRPAFPYKFKFKFDGCPNGCVASMARSDFAVIGTWKDDIKIDQEAVKAYVGGEFKPNAGAHAGRDWGKFDIEAEVVGLCPTGCMTYESGTLSIDNKNCTRCMHCINTMPRALKIGDERGASILVGAKAPVLDGAQMGSLLIPFIAAEEPFDEVKEVIENIWEWWMEEGKNRERLGETMKRVGFQKLLEVTGTKAVPQHVSEPRHNPYIFFKEEEVPGGWSRDISDYRKRHMR 437
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432

Chain E from PDB  Type:PROTEIN  Length:385
 aligned with E2QR96_DESGI | E2QR96 from UniProtKB/TrEMBL  Length:386

    Alignment length:385
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381     
         E2QR96_DESGI     2 AFISSGYNPAKPMENRITDIGPRKFTEFFPPVIAKNAGNWDYHEILEPGILVHVAKNGDKVFTVRCGAARLMSTSHIREACEIAKKFCNGHLRFTTRNNIEFMVDNEETLKALVADLKTRKFAAGSFKFPIGGTGASISNIVHTQGWVYCHTPATDASGPVKAVMDELFEEFTSMRLPAIVRVSLACCINMCGAVHCSDIGLVGIHRKPPMIDHENLAELCEIPLAVAACPTAAVKPITAEVNGQKVKSVAINNDRCMYCGNCYTMCPALPLSDGTGDGIAIMVGGKISNRIKVPSFSKVVVAFVPNEPPRWPTMAKIVKKIVEVYAEDARKYERIGDWIHRIGWETFYEKTGLEFSHHCIDDFRDPAYYTWRQSTQFKFVSFDS 386
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......................hhhhhhhhhhhhhh..eeeeeeee..eeeeee....eeeeeee....eeehhhhhhhhhhhhhhh..eeee.....eeeee.hhhhhhhhhhhhhh.....................ee..hhhhh.......hhhhhhhhhhhhhhhhh.........eeee.......hhhhh.eeeeee.......hhhhhhhhhhhhhhhhh.....eeeeeeee..eeeeeeee........hhhhhhh...........eeeeee..............eeeeeeee.....hhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh...hhhhh...hhhhhhhh........hhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3or1 E   2 AFISSGYNPAKPMENRITDIGPRKFTEFFPPVIAKNAGNWDYHEILEPGILVHVAKNGDKVFTVRCGAARLMSTSHIREACEIAKKFCNGHLRFTTRNNIEFMVDNEETLKALVADLKTRKFAAGSFKFPIGGTGASISNIVHTQGWVYCHTPATDASGPVKAVMDELFEEFTSMRLPAIVRVSLACCINMCGAVHCSDIGLVGIHRKPPMIDHENLAELCEIPLAVAACPTAAVKPITAEVNGQKVKSVAINNDRCMYCGNCYTMCPALPLSDGTGDGIAIMVGGKISNRIKVPSFSKVVVAFVPNEPPRWPTMAKIVKKIVEVYAEDARKYERIGDWIHRIGWETFYEKTGLEFSHHCIDDFRDPAYYTWRQSTQFKFVSFDS 386
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381

Chain F from PDB  Type:PROTEIN  Length:104
 aligned with E2QR98_DESGI | E2QR98 from UniProtKB/TrEMBL  Length:105

    Alignment length:104
                                    11        21        31        41        51        61        71        81        91       101    
         E2QR98_DESGI     2 AVVEFAGSAFEVDEDGFLNAFDDWCPEWVKYAKGSEGIGAGSADHQKIIDFLQDYYKANGIAPMVRILSKNTGFALKEIYELFPSGPGKGACKMAGLPKPTGCV 105
               SCOP domains d3or1f_ F: automated matches                                                                             SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee..eeee........hhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh...hhhhhhhhhh.hhhhhhhhh......hhhhhhh........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------- Transcript
                 3or1 F   2 AVVEFAGSAFEVDEDGFLNAFDDWCPEWVKYAKGSEGIGAGSADHQKIIDFLQDYYKANGIAPMVRILSKNTGFALKEIYELFPSGPGKGACKMAGLPKPTGCV 105
                                    11        21        31        41        51        61        71        81        91       101

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "CATH Domain" information available for 3OR1)

(no "Pfam Domain" information available for 3OR1)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,D (E2QR97_DESGI | E2QR97)

molecular function
	GO:0051539	4 iron, 4 sulfur cluster binding	Interacting selectively and non-covalently with a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands.
	GO:0020037	heme binding	Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
	GO:0018551	hydrogensulfite reductase activity	Catalysis of the reaction: trithionate + acceptor + 2 H2O + OH- = 3 HSO3- + reduced acceptor.
	GO:0051536	iron-sulfur cluster binding	Interacting selectively and non-covalently with an iron-sulfur cluster, a combination of iron and sulfur atoms.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

Chain B,E (E2QR96_DESGI | E2QR96)

molecular function
	GO:0051539	4 iron, 4 sulfur cluster binding	Interacting selectively and non-covalently with a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands.
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0020037	heme binding	Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
	GO:0018551	hydrogensulfite reductase activity	Catalysis of the reaction: trithionate + acceptor + 2 H2O + OH- = 3 HSO3- + reduced acceptor.
	GO:0051536	iron-sulfur cluster binding	Interacting selectively and non-covalently with an iron-sulfur cluster, a combination of iron and sulfur atoms.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0006790	sulfur compound metabolic process	The chemical reactions and pathways involving the nonmetallic element sulfur or compounds that contain sulfur, such as the amino acids methionine and cysteine or the tripeptide glutathione.

Chain C,F (E2QR98_DESGI | E2QR98)

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		SF4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO3	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SRM	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]
		BC2	[ RasMol ]	+environment [ RasMol ]
		BC3	[ RasMol ]	+environment [ RasMol ]
		BC4	[ RasMol ]	+environment [ RasMol ]
		BC5	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Glu A:353 - Pro A:354	[ RasMol ]
		Glu D:353 - Pro D:354	[ RasMol ]
		Lys D:3 - His D:4	[ RasMol ]
		Met A:132 - His A:133	[ RasMol ]
		Met D:132 - His D:133	[ RasMol ]
		Pro B:310 - Pro B:311	[ RasMol ]
		Pro E:310 - Pro E:311	[ RasMol ]
		Val A:335 - Leu A:336	[ RasMol ]
		Val D:335 - Leu D:336	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3or1
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	E2QR96_DESGI \| E2QR96
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL
	E2QR97_DESGI \| E2QR97
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL
	E2QR98_DESGI \| E2QR98
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	E2QR96_DESGI \| E2QR96
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	E2QR97_DESGI \| E2QR97
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	E2QR98_DESGI \| E2QR98
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/TrEMBL
	E2QR96_DESGI \| E2QR96	:	3or2
	E2QR97_DESGI \| E2QR97	:	3or2

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 14)

Sites (14, 14)

SS Bonds (2, 2)

Cis Peptide Bonds (9, 9)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (9, 16)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File