Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE N-TERMINAL DOMAIN OF AN HSP90 FROM TRYPANOSOMA BRUCEI, TB10.26.1080 IN THE PRESENCE OF A BENZAMIDE DERIVATIVE
 
Authors :  J. C. Pizarro, A. K. Wernimont, A. Hutchinson, H. Sullivan, K. Chamberl J. Weadge, D. Cossar, Y. Li, I. Kozieradzki, A. Bochkarev, C. H. Arrows A. M. Edwards, C. Bountra, J. Weigelt, P. G. Wyatt, A. H. Fairlamb, C. Ma M. A. J. Ferguson, R. Hui, T. Hills, Structural Genomics Consortium
Date :  31 Aug 10  (Deposition) - 13 Oct 10  (Release) - 13 Oct 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.60
Chains :  Asym. Unit :  A,B,C
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Keywords :  Structural Genomics, Structural Genomics Consortium, Sgc, Chaperone, Atp Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. C. Pizarro, A. K. Wernimont, A. Hutchinson, H. Sullivan, K. Chamberlain, J. Weadge, D. Cossar, Y. Li, I. Kozieradzki, A. Bochkarev, C. H. Arrowsmith, A. M. Edwards, C. Bountra, J. Weigelt, P. G. Wyatt, A. H. Fairlamb, C. Mackenzie, M. A. J. Ferguson, R. Hui, T. Hills, Structural Genomics Consortium (Sgc)
Crystal Structure Of The N-Terminal Domain Of An Hsp90 From Trypanosoma Brucei, Tb10. 26. 1080 In The Presence Of A Benzamide Derivative
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - HEAT SHOCK PROTEIN 83
    ChainsA, B, C
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET15
    Expression System StrainBL21(DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentN-TERMINAL DOMAIN
    GeneHSP83, TB10.26.1080
    Organism ScientificTRYPANOSOMA BRUCEI BRUCEI
    Organism Taxid5702

 Structural Features

(-) Chains, Units

  123
Asymmetric Unit ABC
Biological Unit 1 (1x)A  
Biological Unit 2 (1x) B 
Biological Unit 3 (1x)  C

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 3)

Asymmetric Unit (1, 3)
No.NameCountTypeFull Name
1HIE3Ligand/Ion4-[6,6-DIMETHYL-4-OXO-3-(TRIFLUOROMETHYL)-4,5,6,7-TETRAHYDRO-1H-INDAZOL-1-YL]-2-[(CIS-4-HYDROXYCYCLOHEXYL)AMINO]BENZAMIDE
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1HIE1Ligand/Ion4-[6,6-DIMETHYL-4-OXO-3-(TRIFLUOROMETHYL)-4,5,6,7-TETRAHYDRO-1H-INDAZOL-1-YL]-2-[(CIS-4-HYDROXYCYCLOHEXYL)AMINO]BENZAMIDE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1HIE1Ligand/Ion4-[6,6-DIMETHYL-4-OXO-3-(TRIFLUOROMETHYL)-4,5,6,7-TETRAHYDRO-1H-INDAZOL-1-YL]-2-[(CIS-4-HYDROXYCYCLOHEXYL)AMINO]BENZAMIDE
Biological Unit 3 (1, 1)
No.NameCountTypeFull Name
1HIE1Ligand/Ion4-[6,6-DIMETHYL-4-OXO-3-(TRIFLUOROMETHYL)-4,5,6,7-TETRAHYDRO-1H-INDAZOL-1-YL]-2-[(CIS-4-HYDROXYCYCLOHEXYL)AMINO]BENZAMIDE

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASN A:36 , ALA A:40 , LYS A:43 , ASP A:78 , MET A:83 , ASN A:91 , LEU A:92 , ILE A:95 , ALA A:96 , GLY A:120 , TYR A:124 , TRP A:147 , THR A:169 , ILE A:171 , HOH A:239 , HOH A:248 , HOH A:355 , HOH A:356BINDING SITE FOR RESIDUE HIE A 214
2AC2SOFTWAREASN B:36 , ALA B:40 , ASP B:78 , MET B:83 , ASN B:91 , LEU B:92 , ALA B:96 , GLY B:120 , PHE B:123 , TYR B:124 , TRP B:147 , THR B:169 , ILE B:171 , HOH B:221 , HOH B:283BINDING SITE FOR RESIDUE HIE B 214
3AC3SOFTWAREASN C:36 , ALA C:40 , ASP C:78 , MET C:83 , ASN C:91 , LEU C:92 , ALA C:96 , GLY C:120 , VAL C:121 , PHE C:123 , TYR C:124 , TRP C:147 , ILE C:171BINDING SITE FOR RESIDUE HIE C 214

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3OPD)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Pro A:161 -Asp A:162
2Ser C:53 -Val C:54

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3OPD)

(-) PROSITE Motifs  (1, 3)

Asymmetric Unit (1, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1HSP90PS00298 Heat shock hsp90 proteins family signature.HSP83_TRYBB23-32
 
 
  3A:23-32
B:23-32
C:23-32
Biological Unit 1 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1HSP90PS00298 Heat shock hsp90 proteins family signature.HSP83_TRYBB23-32
 
 
  1A:23-32
-
-
Biological Unit 2 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1HSP90PS00298 Heat shock hsp90 proteins family signature.HSP83_TRYBB23-32
 
 
  1-
B:23-32
-
Biological Unit 3 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1HSP90PS00298 Heat shock hsp90 proteins family signature.HSP83_TRYBB23-32
 
 
  1-
-
C:23-32

(-) Exons   (0, 0)

(no "Exon" information available for 3OPD)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:208
 aligned with HSP83_TRYBB | P12861 from UniProtKB/Swiss-Prot  Length:703

    Alignment length:210
                             1                                                                                                                                                                                                                
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209
          HSP83_TRYBB     - -MTETFAFQAEINQLMSLIINTFYSNKEIFLRELISNSSDACDKIRYQSLTNQSVLGDEPHLRIRVIPDRVNKTLTVEDSGIGMTKADLVNNLGTIARSGTKSFMEALEAGGDMSMIGQFGVGFYSAYLVADRVTVVSKNNEDDAYTWESSAGGTFTVTSTPDCDLKRGTRIVLHLKEDQQEYLEERRLKDLIKKHSEFIGYDIELMVEN 209
               SCOP domains d3opda_ A: automated matches                                                                                                                                                                                       SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....ee.hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......eeeeee....eeeeee.....hhhhhhhh.hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh.eeeeeeeee......eeeee....eeeeee...--...eeeeeeee.hhhhhhhhhhhhhhhhhhhhh.....eee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -----------------------HSP90     --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3opd A   0 GMTETFAFQAEINQLMSLIINTFYSNKEIFLRELISNSSDACDKIRYQSLTNQSVLGDEPHLRIRVIPDRVNKTLTVEDSGIGMTKADLVNNLGTIARSGTKSFMEALEAGGDMSMIGQFGVGFYSAYLVADRVTVVSKNNEDDAYTWESSAGGTFTVTSTPD--LKRGTRIVLHLKEDQQEYLEERRLKDLIKKHSEFIGYDIELMVEN 209
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159  |  | 169       179       189       199       209
                                                                                                                                                                                            162  |                                            
                                                                                                                                                                                               165                                            

Chain B from PDB  Type:PROTEIN  Length:205
 aligned with HSP83_TRYBB | P12861 from UniProtKB/Swiss-Prot  Length:703

    Alignment length:209
                             1                                                                                                                                                                                                               
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199         
          HSP83_TRYBB     - -MTETFAFQAEINQLMSLIINTFYSNKEIFLRELISNSSDACDKIRYQSLTNQSVLGDEPHLRIRVIPDRVNKTLTVEDSGIGMTKADLVNNLGTIARSGTKSFMEALEAGGDMSMIGQFGVGFYSAYLVADRVTVVSKNNEDDAYTWESSAGGTFTVTSTPDCDLKRGTRIVLHLKEDQQEYLEERRLKDLIKKHSEFIGYDIELMVE 208
               SCOP domains d3opdb_ B: automated matches                                                                                                                                                                                      SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee.hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......eeeeee....eeeeee.....hhhhhhhh.hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh.eeeeeeeee......eeeee....eeeeee..----..eeeeeeee.hhhhhhhhhhhhhhhhhhhh......eee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------HSP90     -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3opd B   0 GMTETFAFQAEINQLMSLIINTFYSNKEIFLRELISNSSDACDKIRYQSLTNQSVLGDEPHLRIRVIPDRVNKTLTVEDSGIGMTKADLVNNLGTIARSGTKSFMEALEAGGDMSMIGQFGVGFYSAYLVADRVTVVSKNNEDDAYTWESSAGGTFTVTSTP----KRGTRIVLHLKEDQQEYLEERRLKDLIKKHSEFIGYDIELMVE 208
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159 |    |169       179       189       199         
                                                                                                                                                                                           161  166                                          

Chain C from PDB  Type:PROTEIN  Length:202
 aligned with HSP83_TRYBB | P12861 from UniProtKB/Swiss-Prot  Length:703

    Alignment length:209
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200         
          HSP83_TRYBB     1 MTETFAFQAEINQLMSLIINTFYSNKEIFLRELISNSSDACDKIRYQSLTNQSVLGDEPHLRIRVIPDRVNKTLTVEDSGIGMTKADLVNNLGTIARSGTKSFMEALEAGGDMSMIGQFGVGFYSAYLVADRVTVVSKNNEDDAYTWESSAGGTFTVTSTPDCDLKRGTRIVLHLKEDQQEYLEERRLKDLIKKHSEFIGYDIELMVEN 209
               SCOP domains d3opdc_ C: automated matches                                                                                                                                                                                      SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ----------------------HATPase_c_3-3opdC01 C:23-185                                                                                                                                       -----------   ---------- Pfam domains (1)
           Pfam domains (2) ----------------------HATPase_c_3-3opdC02 C:23-185                                                                                                                                       -----------   ---------- Pfam domains (2)
           Pfam domains (3) ----------------------HATPase_c_3-3opdC03 C:23-185                                                                                                                                       -----------   ---------- Pfam domains (3)
           Pfam domains (4) ------------------------------------------------------    --------------------------------------------------------------------------------------------------------------------------HSP90-3opdC04 C:   181-209    Pfam domains (4)
           Pfam domains (5) ------------------------------------------------------    --------------------------------------------------------------------------------------------------------------------------HSP90-3opdC05 C:   181-209    Pfam domains (5)
           Pfam domains (6) ------------------------------------------------------    --------------------------------------------------------------------------------------------------------------------------HSP90-3opdC06 C:   181-209    Pfam domains (6)
         Sec.struct. author .eeeee.hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhh...----....eeeeee....eeeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh.eeeeeeeee......eeeee....eeeeee........eeeeeeee.hhhhhhhhhhhhhhhhhhh.---...eee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------HSP90     --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3opd C   1 MTETFAFQAEINQLMSLIINTFYSNKEIFLRELISNSSDACDKIRYQSLTNQSV----PHLRIRVIPDRVNKTLTVEDSGIGMTKADLVNNLGTIARSGTKSFMEALEAGGDMSMIGQFGVGFYSAYLVADRVTVVSKNNEDDAYTWESSAGGTFTVTSTPDCDLKRGTRIVLHLKEDQQEYLEERRLKDLIKKHS---GYDIELMVEN 209
                                    10        20        30        40        50   |    60        70        80        90       100       110       120       130       140       150       160       170       180       190     | 200         
                                                                                54   59                                                                                                                                      196 200         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 3)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3OPD)

(-) Pfam Domains  (2, 6)

Asymmetric Unit
(-)
Family: HSP90 (107)

(-) Gene Ontology  (11, 11)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C   (HSP83_TRYBB | P12861)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0042623    ATPase activity, coupled    Catalysis of the reaction: ATP + H2O = ADP + phosphate; this reaction directly drives some other reaction, for example ion transport across a membrane.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0051082    unfolded protein binding    Interacting selectively and non-covalently with an unfolded protein.
biological process
    GO:0006457    protein folding    The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure.
    GO:0042026    protein refolding    The process carried out by a cell that restores the biological activity of an unfolded or misfolded protein, using helper proteins such as chaperones.
    GO:0009408    response to heat    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a heat stimulus, a temperature stimulus above the optimal temperature for that organism.
    GO:0006950    response to stress    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a disturbance in organismal or cellular homeostasis, usually, but not necessarily, exogenous (e.g. temperature, humidity, ionizing radiation).
    GO:0006986    response to unfolded protein    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an unfolded protein stimulus.
cellular component
    GO:0005813    centrosome    A structure comprised of a core structure (in most organisms, a pair of centrioles) and peripheral material from which a microtubule-based structure, such as a spindle apparatus, is organized. Centrosomes occur close to the nucleus during interphase in many eukaryotic cells, though in animal cells it changes continually during the cell-division cycle.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    HIE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Pro A:161 - Asp A:162   [ RasMol ]  
    Ser C:53 - Val C:54   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3opd
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  HSP83_TRYBB | P12861
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  HSP83_TRYBB | P12861
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3OPD)

(-) Related Entries Specified in the PDB File

3o6o 3omu