|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (5, 11)| Asymmetric Unit (5, 11) Biological Unit 1 (4, 20) |
Sites (6, 6)
Asymmetric Unit (6, 6)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3ONP) |
Cis Peptide Bonds (1, 1)
Asymmetric Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3ONP) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3ONP) |
Exons (0, 0)| (no "Exon" information available for 3ONP) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:159 aligned with Q3IXX1_RHOS4 | Q3IXX1 from UniProtKB/TrEMBL Length:243 Alignment length:159 12 22 32 42 52 62 72 82 92 102 112 122 132 142 152 Q3IXX1_RHOS4 3 IEPVFILVRPQMGENIGAAARAMLNFGLGRLRIVDPRDGWPNPKAVAMASGAGRLLDHAGLFPTVAEAIRDCDYVFATTARGRELTKPVMTPERAMAHGRALTGEGRRVGILFGPERTGLENEDVALANAIVTVPVNPEFFSLNLAQCVLLLAYEWRRQ 161 SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -SpoU_methylase-3onpA01 A:4-156 ----- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 3onp A 3 IEPVFILVRPQmGENIGAAARAmLNFGLGRLRIVDPRDGWPNPKAVAmASGAGRLLDHAGLFPTVAEAIRDCDYVFATTARGRELTKPVmTPERAmAHGRALTGEGRRVGILFGPERTGLENEDVALANAIVTVPVNPEFFSLNLAQCVLLLAYEWRRQ 161 12 | 22 | 32 42 |52 62 72 82 92 | 102 112 122 132 142 152 14-MSE 25-MSE 50-MSE 92-MSE | 98-MSE
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3ONP) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3ONP) |
Pfam Domains (1, 1)| Asymmetric Unit |
Gene Ontology (9, 9)|
Asymmetric Unit(hide GO term definitions) Chain A (Q3IXX1_RHOS4 | Q3IXX1)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|