|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| Asymmetric Unit (2, 2) Biological Unit 1 (1, 2) Biological Unit 2 (0, 0) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3OMY) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3OMY) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3OMY) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3OMY) |
Exons (0, 0)| (no "Exon" information available for 3OMY) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:51 aligned with TRAM8_ECOLX | P33788 from UniProtKB/Swiss-Prot Length:127 Alignment length:51 11 21 31 41 51 TRAM8_ECOLX 2 PKIQTYVNNNVYEQITDLVTIRKQEGIEEASLSNVSSMLLELGLRVYMIQQ 52 SCOP domains d3omya_ A: automated matches SCOP domains CATH domains --------------------------------------------------- CATH domains Pfam domains --------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------- PROSITE Transcript --------------------------------------------------- Transcript 3omy A 2 PKIQTYVNNNVYEQITDLVTIRKQEGIEEASLSNVSSMLLELGLRVYMIQQ 52 11 21 31 41 51 Chain B from PDB Type:PROTEIN Length:50 aligned with TRAM8_ECOLX | P33788 from UniProtKB/Swiss-Prot Length:127 Alignment length:50 11 21 31 41 51 TRAM8_ECOLX 2 PKIQTYVNNNVYEQITDLVTIRKQEGIEEASLSNVSSMLLELGLRVYMIQ 51 SCOP domains d3omyb_ B: automated matches SCOP domains CATH domains -------------------------------------------------- CATH domains Pfam domains (1) Tra_M-3omyB01 B:2-51 Pfam domains (1) Pfam domains (2) Tra_M-3omyB02 B:2-51 Pfam domains (2) SAPs(SNPs) -------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------- PROSITE Transcript -------------------------------------------------- Transcript 3omy B 2 PKIQTYVNNNVYEQITDLVTIRKQEGIEEASLSNVSSMLLELGLRVYMIQ 51 11 21 31 41 51
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3OMY) |
Pfam Domains (1, 2)
Asymmetric Unit
|
Gene Ontology (5, 5)|
Asymmetric Unit(hide GO term definitions) Chain A,B (TRAM8_ECOLX | P33788)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|